Geet - Hui Sabse Parayee

India-Forums

   
Geet - Hui Sabse Parayee
Geet - Hui Sabse Parayee

MSK to his fanz from the sbs segment...

bobby13rocks IF-Stunnerz
bobby13rocks
bobby13rocks

Joined: 29 September 2010
Posts: 36197

Posted: 23 May 2011 at 4:11am | IP Logged
Maan despo to become MSK again.Wink.too tired of being Balwant Singh..Confused
Letz find out what he has to say...Wink

Maan-Haiii kab mujhe Balwant Singh se wapas  Maan Sigh Khurana ka position milega..Cry



Maan- mei toh thak gaya gadi dhote dhote aur Geet ki parivar ko khush karte karte ...mujhe KM lautna hai...Confused


Maan- yeh cv's bhi na mujhe muft mei double role kaarwa diye woh bhi single fees mei.Wink.abh bohot ho chuke baas..either give back my position as MSK or I'll charge double.LOL

Now Geet giving Maan some consolation..
Geet- Maan aap chinta maat kijiye ..aapko jald MSK ki position milne wala hai...aap bas humare next action ki baare mei sochiye..Embarrassed
Maan- pehle MSK ki position toh regain karne doh phir uske baad sochenge..Wink


Geet- kahi aap ke baad mei sochne ki chakkar mei hume fhir se tabele mei lantern ki saath SR na mil jaye..LOL
Maan- iss bar agar cv's kuch ayse sequence laate hai toh mei pehle unhe karke dikhane ko bolunga..fhir hum karenge..Embarrassed


Geet-kahi cv's ke dikhane ki chakkar mei hum peeche choot na jaaye .Wink.aur cv's ka hi final take ho jaaye..LOL
Maan-tum chinta maat karo Geet..unke action se pehle hi hum cut bol denge.Wink.jaise woh humare saath kiye thhe..'tit for tat'ROFL


Edited by bobby13rocks - 23 May 2011 at 5:43am

The following 20 member(s) liked the above post:

laila889visheshsSominababahadahsunithavarmaMounchysiroililytazeen_29LadyArwenRishabala.loveEccentric.Being_Rashmiminnie_tweetieLuvScoobymechantefilleanshramaaniqrakhushimuskaanFallen Angelblackb28

_Rashmi IF-Rockerz
_Rashmi
_Rashmi

Joined: 11 February 2011
Posts: 6254

Posted: 23 May 2011 at 4:29am | IP Logged
n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
 
luved the captionsBig smile

The following 3 member(s) liked the above post:

SominababaiMadzbobby13rocks

bobby13rocks IF-Stunnerz
bobby13rocks
bobby13rocks

Joined: 29 September 2010
Posts: 36197

Posted: 23 May 2011 at 4:34am | IP Logged
Originally posted by lovelygeet24x7

n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
 
luved the captionsBig smile
Rash ..I've updated a bit ..have a look dear..

Thanxx for liking it..Smile

The following 1 member(s) liked the above post:

_Rashmi

minnie_tweetie IF-Rockerz
minnie_tweetie
minnie_tweetie

Joined: 23 July 2010
Posts: 8000

Posted: 23 May 2011 at 4:37am | IP Logged
superbb...Clap
loved ur post...amazing...!!!!!!

The following 1 member(s) liked the above post:

bobby13rocks

maaniqra IF-Sizzlerz
maaniqra
maaniqra

Joined: 15 November 2009
Posts: 22531

Posted: 23 May 2011 at 4:38am | IP Logged
ROFL

The following 1 member(s) liked the above post:

bobby13rocks

_Rashmi IF-Rockerz
_Rashmi
_Rashmi

Joined: 11 February 2011
Posts: 6254

Posted: 23 May 2011 at 4:38am | IP Logged
Originally posted by bobby13rocks

Originally posted by lovelygeet24x7

n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
 
luved the captionsBig smile
Rash ..I've updated a bit ..have a look dear..

Thanxx for liking it..Smile
 
seen.i m likeROFLROFLROFL.luved the last para especially tit 4 tatROFLROFL
 
 maaneet's 2nd sr in a matEmbarrassedROFL

The following 2 member(s) liked the above post:

Sominabababobby13rocks

bobby13rocks IF-Stunnerz
bobby13rocks
bobby13rocks

Joined: 29 September 2010
Posts: 36197

Posted: 23 May 2011 at 4:39am | IP Logged
Originally posted by silkyarora

superbb...Clap
loved ur post...amazing...!!!!!!
Thanxx dear for ur appreciation..Smile

The following 1 member(s) liked the above post:

minnie_tweetie

bobby13rocks IF-Stunnerz
bobby13rocks
bobby13rocks

Joined: 29 September 2010
Posts: 36197

Posted: 23 May 2011 at 4:42am | IP Logged
Wink
Originally posted by lovelygeet24x7

Originally posted by bobby13rocks

Originally posted by lovelygeet24x7

n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
 
luved the captionsBig smile
Rash ..I've updated a bit ..have a look dear..

Thanxx for liking it..Smile
 
seen.i m likeROFLROFLROFL.luved the last para especially tit 4 tatROFLROFL
 
 maaneet's 2nd sr in a matEmbarrassedROFL

Actually they r not not allowing to post any pics ...closing the topics...so just to post these pics made these captions hastily...Wink
Hope from haystack they don't land in a mat..LOL

The following 2 member(s) liked the above post:

Sominababa_Rashmi

Go to top

Related Topics

  Topics Author Replies Views Last Post
GEET On SBS Segment

Author: BrOkeN   Replies: 0   Views: 797

BrOkeN 0 797 11 August 2010 at 11:50am by BrOkeN
guyz r v in fr 1 mre mirchi segment..hehe

Author: adits7   Replies: 0   Views: 3509

adits7 0 3509 26 July 2010 at 2:42pm by adits7
Maneet SBS segment PICS... all updated..chk it

2

Author: bubblygal1711   Replies: 15   Views: 2829

bubblygal1711 15 2829 21 July 2010 at 9:00am by 49erFan
dev's fanz...

2

Author: Pinam3   Replies: 15   Views: 1036

Pinam3 15 1036 08 July 2010 at 4:10pm by raym1

Forum Quick Jump

Forum Category / Channels
Forums

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index