Geet - Hui Sabse Parayee

India-Forums

   
Geet - Hui Sabse Parayee
Geet - Hui Sabse Parayee

Ehsaas/ GHSP Anniversary 3-5 part sci fi /updating today

Sonia.KN IF-Sizzlerz
Sonia.KN
Sonia.KN

Joined: 13 October 2010
Posts: 14835

Posted: 20 April 2016 at 4:32am | IP Logged


I wasn't able to post my GHSP Anniversary OS but today hopefully I will If I find you are able to understand what strange plot I have with a glimpse of trailer..Will be available on My Blog without password..An extract of my untouched story :       

                                   
                            " Khamoshain...Sun Zaraa "


                                                OS name I changed to :
                                          
                                                   Ehsaas


"Tumse shaddi...koi mazaak hai.." he taunted ..." aisa hona to kya..hum kabhi soch bhi nahi sakte" he burst in repudiation..His blood boiled just with a thought of it..

" Dr.Saab..I know..its beyond imagination for you to marry me..But you don't have any option left with to save ur race.." She marked her determination very calmly...

" Ha wo to hai...to kill me first it was your only motif...and now.!!! "  he sneered.."and now make me your salve with lame excuse of marriage ...huh.what is the difference then ? " he smuggled judging her intentions...


His dedication towards his relations..his expression of love for  Naina alias   NainTara in these devastating circumstances...When whole humankind was at the verge of devastation...Above all  his Greek God like appearance totally converted her mind... An Assassinator sent to kill him... turned out to be  Guardia Angel not just for him but for every being on Planet called Earth..


" Believe me. Yes I was here to kill you...But now..!!! " she couldn't express what made her to change her mind..


" But !!! " He said raising his eyebrow..being amazed glared at her with his big broad light brown eyes..

" Dr. Saab!!! mujhe nahi patta kya kahun ? Ehsaas kya hai hamari nasal ( race ) ko nahi patta.. " Streak of strange pink liquid marked her cheek from her eyes " Kyonki hum soch sakte hai ..mehsoos karna ek gunah/(crime) hai hamaare liye..or shaayed main kar beithi hu " She grabbed him from biceps daringly in a jiffy..A tight grip of her hold ached his whole body..

" Dr.ArayaMaan Singh Khuraana please came back to reality now from ur fantasy world..."Some one patted on his cheek lovingly .He jerked his head off.

A pleasant smile spread on his perfect M shape lips just with a glimpse of his beautiful wife ...



Soina

 to be continued...



Edited by Sonia.KN - 11 July 2016 at 5:38am

The following 61 member(s) liked the above post:

aaahsapcavidz.manirajsathiyapalaninikitaagarwal06RHEA123Paingelasmi123preet.harmansuwaibahsonamiglesiassonu22poojitha96piyabulsaraketki61varthyadi000sanafatima35leena63pari1689gurtimuskaansree10ambeernRocks.Dharaficthottyangelcrazyfriends007sheetalvasapreetidhawanmishtypievasavi_sriKawancuticalMadhu..anu5GeetMeetgill123kabslocksHanishadevisimi91jayshu17awesomepoojanakh5683ambbihaalekhika20prerna1pop77love2_soma6n6s6k6i6r6a6n6angeldream14GudiyeetKINGKHANFANheemasomaniSANJANA9167sanum23sanghita0000aparna3011mushatMona_90taahir004priya_21vrinda22khwaishfan

nakh5683 IF-Rockerz
nakh5683
nakh5683

Joined: 19 July 2010
Posts: 8440

Posted: 20 April 2016 at 4:45am | IP Logged
strange prologue seema the killer fell for her prey or its maan starnge dream watever it is seems interesting uodate soon

The following 1 member(s) liked the above post:

Sonia.KN

heemasomani IF-Sizzlerz
heemasomani
heemasomani

Joined: 26 August 2013
Posts: 11922

Posted: 20 April 2016 at 4:57am | IP Logged
Interesting one 

The following 1 member(s) liked the above post:

Sonia.KN

SANJANA9167 IF-Sizzlerz
SANJANA9167
SANJANA9167

Joined: 14 April 2014
Posts: 17050

Posted: 20 April 2016 at 5:14am | IP Logged
Interesting and mysterious
Seems like prey and predator fell in love.
Willb waiting for more

The following 1 member(s) liked the above post:

Sonia.KN

taahir004 IF-Stunnerz
taahir004
taahir004

Joined: 12 April 2012
Posts: 39207

Posted: 20 April 2016 at 5:17am | IP Logged
Intriguing Prologue
 
I'm not if its Dr Maan's dream or is it reality
so the alien Naintara changed her mind and for whatever reason humanity has been saved
Maan married but who is his wife ...Naintara ?
waiting for the story to unfold

The following 1 member(s) liked the above post:

Sonia.KN

alekhika20 IF-Rockerz
alekhika20
alekhika20

Joined: 07 July 2008
Posts: 8153

Posted: 20 April 2016 at 5:18am | IP Logged
Interesting prologue, updt soon.
Waiting .

The following 1 member(s) liked the above post:

Sonia.KN

mishtypie IF-Dazzler
mishtypie
mishtypie

Joined: 23 January 2014
Posts: 4547

Posted: 20 April 2016 at 5:21am | IP Logged
Intrstng prolouge di
waitng 4 d update

The following 1 member(s) liked the above post:

Sonia.KN

Sonia.KN IF-Sizzlerz
Sonia.KN
Sonia.KN

Joined: 13 October 2010
Posts: 14835

Posted: 20 April 2016 at 5:36am | IP Logged
Originally posted by taahir004

Intriguing Prologue
 
I'm not if its Dr Maan's dream or is it reality
so the alien Naintara changed her mind and for whatever reason humanity has been saved
Maan married but who is his wife ...Naintara ?
waiting for the story to unfold

Hi Taahir its not Naintara but his love for Naintaraa changed his assassinator's mind ..I know is confusing 

Go to top

Related Topics

  Topics Author Replies Views Last Post
This is my GHSP...Our GHSP..Maaneet n Only Maaneet

2 3 4

Author: rickks   Replies: 25   Views: 14857

rickks 25 14857 12 February 2012 at 11:52am by appla
Plz SEE SAVE GHSP MAANEET GHSP SEASON 2

Author: sptrno   Replies: 9   Views: 3073

sptrno 9 3073 16 December 2011 at 12:55pm by -Priti11-
Our Journey with GHSP and GHSP Forum

2

Author: ..natasha..   Replies: 13   Views: 3554

..natasha.. 13 3554 10 December 2011 at 2:47pm by liana786
Mr.Vishal-GHSP team on star1 says GHSP not ending

2 3

Author: dewdropred   Replies: 23   Views: 7628

dewdropred 23 7628 06 July 2011 at 5:23pm by maneet_forever9
To the New GHSP and the OLD GHSP Team

2 3 4 5 6

Author: mysterygurl1427   Replies: 41   Views: 10150

mysterygurl1427 41 10150 22 April 2011 at 3:02pm by cameroon16

Forum Quick Jump

Forum Category / Channels
Forums

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index