Ye Hai Mohabbatein

India-Forums

   
Ye Hai Mohabbatein
Ye Hai Mohabbatein

New On Loc - 26/12 - WU Added

QueSeraSera IF-Stunnerz
QueSeraSera
QueSeraSera

Joined: 05 May 2006
Posts: 30325

Posted: 26 December 2014 at 11:18am | IP Logged




WU in a while

video 1 - Ishita is holding the specs Raman had on today and is saying she would wear them while Raman is trying to take them away from her in the process she lands up in his arms she is smiling and laughing saying I would see now before that happens. Raman says specs are not neededsince you are standing so close to me as he moves aside a lock of her hair 

They are interrupted by Shagun who came to use the washroom in their bedroom but Anita isnt shown in the clip 


video  2 -  the video starts with him saying he doesnt need the specs Ishita says you arent saying what needs to be said they have a little banter as he says you can say too and she does the same. Raman says if you are stubborn so am I when they are interrupted 

Raman is fuming it seems as he says was this the only bathroom in the whole place Shagun could use Ruhi' room has one too Ishita says its fine and just drop the matter come and have breakfast he leaves the room muttering its the heights 

video 3 - DT' byte is shown she says its a cute sequence where Raman is teasing her wearing x-ray glasses and somehow the scene turns romantic where Shagun interferes the moment She says Raman wanted to give her a tablet as a christmas gift but she refuses as she wants something else from him She says the current phase of their relationship is sweet they are in love but not saying out loud the words thats what she wants as a gift from him on christmas - that he confess first to her but he is being stubborn and not saying the words she says she doesnt know about the future of Shagun' plans as of now 



Edited by EkPaheli - 26 December 2014 at 12:08pm

The following 126 member(s) liked the above post:

shelly_22Kavita1970jyoti_11UniqueUjjainininnu4udilpreetdua24Rusiranlawrencemelody23ishra7p56789Maliummayamaya9Divan.ctamanoDilcwfriendofallluks28yhmssangeethbalakaterinapetrovasweety_virgo1jshree_ramDesiGirl2291alin1113cool_arpanaIshu27arshi33Nehamak1234day_lilyRianshiDivSoumyadrishtimauryaBlue2020DiVAnCRazyFAngreenieJwalitaN.R.Ronajothi_ishraeviltwin_14iyuvi..Maayah..MeeraHKvanisreeNeenuAmmu4856CrAZiVrAzItashug9rnarayansparkleaminamischiefsskaziiViji15Hsp.canadanrn1486rose1000smilydearScribble_TweetymodernfamilyDivancrazeankita_sidanadesire_nikkishravsssVsoujanyaexploringmyselfkabeeambrzksahelilovesishrcrazy_bholiJyoeshinseenNandini6AnnthewMehak_KPianSrujana7.MaNan.Ranju.JniISHRA83momb24shidin0117SuryaIshraholicDivan.Pooja-Hima-nehaarshi09-JujuKRibelleFr0zenJUHI.HIVasuKaShliciousBruce_Lavni_19black_haze_Dipsi_-Garima--AmalAziz-RomComFanAkshatha19..TU...peace..sweety_10Nisha0604SAKIVIAMakdhaloveritsme_aishThe_ImanePrabh.-HoneyDukes--K.13-RollingStonesBul3Autumn.--Nargis--princy48..Arooj..-kri-omshreejaanuShee_xaanAngel13-Gan---HANISA--sweetnoori_Divya_SIKinLoVE.Jayashree.usaonlyNikki_TitliNichuss

itsme_aish IF-Sizzlerz
itsme_aish
itsme_aish

Joined: 10 February 2014
Posts: 20472

Posted: 26 December 2014 at 11:22am | IP Logged
Haila..this looks goodBig smileShocked Tfs AaniBig smile

The following 2 member(s) liked the above post:

Kavita1970Shee_xaan

sujana21 Groupbie
sujana21
sujana21

Joined: 19 April 2013
Posts: 181

Posted: 26 December 2014 at 11:28am | IP Logged
Ishu looking very pretty... Karan hot as always... Love Divan

The following 3 member(s) liked the above post:

Kavita1970AnnthewShee_xaan

Angel13 IF-Sizzlerz
Angel13
Angel13

Joined: 27 December 2011
Posts: 14550

Posted: 26 December 2014 at 11:29am | IP Logged
Tfs dear
Ishra scene on the way
Ishra close close
But damn shagun kabab main haddi comes in their room
so she intentionally comes to their room on pretance of using their bathroom
Ishu asks raman to go while shaguniya is in bathroom I assume
Hope now raman doesn't come back to room and shagun intentionally wears revealing cloths and we witness dirty scenes of her with raman her trying to seduce raman
I really hope it doesn't happen as such
But now that she has seen them together close surely will plan something and maybe get successful to be close with raman for a while using Adi grrr
Damn can't tolerate her anymore
Angry

The following 4 member(s) liked the above post:

hemanshieviltwin_14lovepreet29ambrzk

Veeann IF-Dazzler
Veeann
Veeann

Joined: 03 July 2014
Posts: 4175

Posted: 26 December 2014 at 11:30am | IP Logged
TFS

Edited by Veeann - 26 December 2014 at 11:29am
DiVAnCRazyFAn Senior Member
DiVAnCRazyFAn
DiVAnCRazyFAn

Joined: 11 April 2013
Posts: 646

Posted: 26 December 2014 at 11:32am | IP Logged
OMG!! did i just here raman saying " waise bhi jis distance me hum hein, mujhe nahi lagtha glasses ki zaroorat hein??" arey wah!! puttar toh gutter minded hogaya!!Embarrassed

The following 17 member(s) liked the above post:

Divan.drishtimauryakaranlakshSimRisevanisreeCrAZiVrAzIambrzkAnnthewJyoelovepreet29shravsss.TIA.Divan.PoojaThe_Imaneitsme_aish--HANISA--Angel13

Bruce_L IF-Rockerz
Bruce_L
Bruce_L

Joined: 27 August 2010
Posts: 9643

Posted: 26 December 2014 at 11:34am | IP Logged
Thanks Aani Tongue

Shagun is the AGMARK certified cupid of IshRa.
Hence proved Approve LOL


The following 12 member(s) liked the above post:

drishtimauryaiyuviDharanijaSimRiseAnnthewgeethikashidin0117shravsssNisha0604itsme_aishColt.PixyNikki_Titli

sparkleamina Goldie
sparkleamina
sparkleamina

Joined: 04 October 2011
Posts: 1036

Posted: 26 December 2014 at 11:34am | IP Logged
So the x ray glasses make a comeback!! 
A fab IshRa scene coming up...can't wait <3

The following 3 member(s) liked the above post:

Annthewshravsssishra_bestluv

Go to top

Related Topics

  Topics Author Replies Views Last Post
New Promo/Link Added/Caps Added

2

Author: -DivAn-   Replies: 12   Views: 5965

-DivAn- 12 5965 18 December 2014 at 12:18pm by SimRise
DivAn on stage pics more added/LINK ADDED

2 3 4 5 6 7 ... 10 11

Author: ...RamonaG....   Replies: 81   Views: 18703

...RamonaG.... 81 18703 06 December 2014 at 3:23am by ShaitaanKiKhala
U Me tv Segment 20 NOV PICS ADDED/UPDATED/LINK ADDED

2 3 4 5 6 7 ... 11 12

Author: ...RamonaG....   Replies: 88   Views: 16115

...RamonaG.... 88 16115 20 November 2014 at 11:17am by desire_nikki
KP 'new tweet +selfie(full pic added) one more tweet added

Author: v.s.k_fangirl   Replies: 7   Views: 4635

v.s.k_fangirl 7 4635 18 November 2014 at 1:09am by Mages
SBS updated PICS added LINK added

2 3 4 5 6 7 8

Author: ...RamonaG....   Replies: 59   Views: 15903

...RamonaG.... 59 15903 19 September 2014 at 5:07pm by nancysa

Forum Quick Jump

Forum Category / Channels
Forums

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index