Qubool Hai

India-Forums

   
Qubool Hai
Qubool Hai

Asad Hugs Zoya New Pics

Khilonaa IF-Sizzlerz
Khilonaa
Khilonaa

Joined: 19 October 2010
Posts: 16546

Posted: 26 June 2013 at 7:23am | IP Logged


Asad Hugs Zoya and Talks To Her, Feeling Sorry. (Probably Dream)


Credit: Me. Please Do Hit Like ButtonLOL




Edited by .FlamingDesire. - 26 June 2013 at 7:24am

The following 107 member(s) liked the above post:

dhanrajieaws0melmaharajhSumeer2024reemaaz_786asyaashuAnam888abc123xyz123jasman10101Codefouralana1deepitnavya14yogieBarundeewaniojas143desiangel24nikkipunjfudgepwincessnoor jSATD06recoupkash_meet10NEETANAMEswarobi1aneesa88jinelle20rinky88mahalaxmikSWAN123priyavishu18kabhimitwaasyaimraveenapallavisarkarsanjana39NVBGKYsumatra1234girl_sweet22Abhi_pragyamsleeJaren93....SankaDevi...fee-feediana72parthpathak31BARUNILU_ArshiPasyafathima85Heartbeat123ShoSurbhiddictzoyamaniac--Jenelle--luvushivin1sowmy18hkhb17Asya0910-Devanshi-mamathasridhar..PlayfulKiss..AsadkiDeewanirani2007unna_178Love_FamilyIIdewaaneIINiharika17Asya_MaaneetApplefasyaforlifeWhenInRomesophie420HafsprinceegoyalSrujana7.MaNanrads73937Rarepearl...MonaCo...arnav4everbanushivaniKambakthIshqDarine1980Maneesha_Shanakroseflower_07iheartChaiamruta04...Arjuneeti...LuvUAsYaRuchikaarvilovekankabhorAlwaysAsYa-khaleesi-GoodyTwoShoesviya.mallik4evaFlame.Of.RoseDiVirgo-ElmoFuj-...Tanu....LilGreenRobot..FairyDust.SaraliciousNithiya95KulfiBaisumaiya14FhatTheWuck.SenoritaaaDreALinsieshanakyasharan

sumaiya14 IF-Stunnerz
sumaiya14
sumaiya14

Joined: 01 September 2012
Posts: 24821

Posted: 26 June 2013 at 7:25am | IP Logged
Awww Day Dreaming

The following 1 member(s) liked the above post:

Sumeer2024

...Arjuneeti... IF-Rockerz
...Arjuneeti...
...Arjuneeti...

Joined: 09 January 2013
Posts: 8455

Posted: 26 June 2013 at 7:25am | IP Logged
Aww TFS
Maneesha_Shanak IF-Rockerz
Maneesha_Shanak
Maneesha_Shanak

Joined: 30 September 2010
Posts: 8848

Posted: 26 June 2013 at 7:27am | IP Logged
Thanks for sharing!!
--Jenelle-- Coolbie
--Jenelle--
--Jenelle--

Joined: 26 June 2012
Posts: 23089

Posted: 26 June 2013 at 7:31am | IP Logged
so sweet...Day Dreaming
Tfs

i'm thinking it's probably a dream sequence.

The following 1 member(s) liked the above post:

Linsie

..preethi.. IF-Sizzlerz
..preethi..
..preethi..

Joined: 05 August 2011
Posts: 21974

Posted: 26 June 2013 at 7:34am | IP Logged
IS It dream seq?
Khilonaa IF-Sizzlerz
Khilonaa
Khilonaa

Joined: 19 October 2010
Posts: 16546

Posted: 26 June 2013 at 7:35am | IP Logged
Yeh it seems like a dream

The following 1 member(s) liked the above post:

iheartChai

AsadkiDeewani Goldie
AsadkiDeewani
AsadkiDeewani

Joined: 21 November 2006
Posts: 1847

Posted: 26 June 2013 at 7:36am | IP Logged
Thx for the pics. I also think its a dream before he heads to Ajmer. can't wait..I think its most probably gonna be aired today Smile

The following 1 member(s) liked the above post:

Sumeer2024

Go to top

Related Topics

  Topics Author Replies Views Last Post
Asad Asad Asad

2 3

Author: -Amby-   Replies: 16   Views: 8280

-Amby- 16 8280 29 November 2013 at 9:08am by ..Zainab..
Asad's male friends - Asad's time to get jealous!

2 3 4 5

Author: nmarkan   Replies: 35   Views: 15232

nmarkan 35 15232 21 July 2013 at 11:35am by -AppleOfMaEye-
Asad turns soft 4 Zoya,Tanveer try get Asad closer

2

Author: zan101   Replies: 15   Views: 9880

zan101 15 9880 25 June 2013 at 6:58pm by zan101
ASAD ASAD ASAD i love you KSG

Author: -GoogleWithMe-   Replies: 9   Views: 5186

-GoogleWithMe- 9 5186 27 May 2013 at 11:38am by tareyfan
Asad..Asad..Asad

2 3

Author: Eternal1234   Replies: 16   Views: 5189

Eternal1234 16 5189 19 April 2013 at 7:37pm by ..sweetchilly..

Forum Quick Jump

Forum Category / Channels
Forums

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index