Fan Fictions
Fan Fictions
Fan Fictions




Rasgulla_sp IF-Stunnerz

Joined: 16 January 2012
Posts: 32291

Posted: 05 June 2013 at 8:22am | IP Logged

No, I do not have a blog.

Edited by Rasgulla_sp - 17 November 2013 at 3:31am

The following 79 member(s) liked the above post:


Rasgulla_sp IF-Stunnerz

Joined: 16 January 2012
Posts: 32291

Posted: 05 June 2013 at 8:22am | IP Logged

No, I do not have a blog.

Edited by Rasgulla_sp - 17 November 2013 at 3:13am

The following 455 member(s) liked the above post:

sudumonck1985harini19zil143anaviabhiShini.Shiva86mishimradhagauriJaneRochesterLovenallRain_droprithuparnakk10underground1crazy.kiya.reipkknd17shasunleo2205Coolio56khubsbanuradhathepelicanpra12_anarishigunjanabcdzshree_27Hope1007zenith_zzKhatijahhopalongawsomechokriNova555rdwsydsmile_n_laughsusanbones1sarunfantomchi94princessep13priyankasan02swathivasisthanoushirireetjsaborni123raniushamriga yadavgugguanu1017hajrchitrajayhiuytlmsparikhAnvi2009amaypranaydevishreemarch2011aafanRhysennkdsubsKittya_Cullensmileyhug7679tanurocksAparameghaN0306devsumMaddy1270cool_tweetyaycma98arshiyanaLove_SALeenaRocksmsinHriju321Hina69KishmishsiamesecatemistrySamyxxwonderblake__blossom__simi58TwilightStar_JPkinjalcp87shiv456cheval-DobByDoDgeR-swatim318Dalmuthuyasegadsushnadeep5128ApoorvaraniP4rveen12rakenduvadanaramyarnpraseethamissmkkhushboo1234IronButterflyMaghinallsegretluvbugSS88SnoowfallPhoenixTearskushiarnav1samiraoamus5Hawa1997adhu11DivyahetPdrovermahrusweetyAisha1996aysemLDGaashi12honey-sweetyBlackHolekclovearshiaaytEXPELLIARMUSnaughtymallusruthick...Iyla...yoga123Take_Thataquagalkooltoadxbeyondwordsxdeeswarnamints23-FriedriceJi-chulbuli94daisydee425snoopy84Raadhiyaaariafnalaksh65frenzyychandana.sdennisdmenaceVYGA89gogumazafiHot.Pink.Heelssudhareddypriasweetrini_katAmti4uayshaomarlara3110roops82-memorable-smanridizzzmeloniedebby_11soapsudsshonagudiaAR_EternalLove-Prithi-jakhushi-Xpress-Bigbang_GDAkorshishalini_sflowers4u-Cheeni--afsha-shaliOmNaMaSteOmkeenu_kkragvir.fanThanuAdityapixiegirlMyra.nellyChitraF-aparna-ajoopLyssaPiesilvia1999rkapoor1382sarunsashasinghNewbiesoapfanopsyellowOmorabotiSrilathalollaseeta_naipsRami92thulasi_arshijas0308diyadivyafffan123Kalyaanipup03ranogillkondhili1chillyflutterlashesEccentricanishu_shornaDr.AALUSLOLWAjtmbarunvandana.sagarasrcraze.Nightingale...chavvi16nikita_88MysticRiverdumasmishti_17spvd

asrcraze IF-Stunnerz

Joined: 09 April 2012
Posts: 34311

Posted: 05 June 2013 at 8:23am | IP Logged

Meri Saiyu <3

Thank you thank you thank you for the dedication !!
And for all those things you have said about me ! This is like the best thing anybody has ever done for me ! You have no idea how special I felt when I read this !! 

And it is my privilege to know you !!

And I'm no Co-author to this story ...Credit goes to Saiyu, Saiyu and Saiyu only! 

And avcmyd a big Thank you to you for asking V to make the banner and thanks again for all the comments you leave for me on the thread! You make me feel so good :)
I really loved the gif Hug (though I have no idea who those guys were and what he was sayingTongue )

Thanks to all of you who mention me in their comments :)

Thanks V ...for the banner...Its awesome :)

Accha lagta hain Embarrassed



  Over to this update's Comment !                                           








Edited by asrcraze - 08 June 2013 at 8:21am

The following 88 member(s) liked the above post:

Rain_dropanamika00seemaaryansangeethbalaSaRUNiansFOREVAarshifan91Sonia_J16sarun_nbcutiepie_ashsrithaAnne_ArHianusha.nushKeenaraday_lilythebubblespop12ArmelaARSHI_FAN11smarty94Paridhi7250anumadduriglimmernglittermrignayanikhushiiXOXOavantika_2012RandomGirlAMAL722Shweta1691-Siaa-yusamSirenMitraAmiarismesrija.singh04divyaarnavsrcelinawalterammavedu80jg12DivyahetPdrovermahrusweetySilentShadowP4rveen12Hawa1997luvbugSanaya.BarunKishmishHina69Maddy1270siamesecatwonderblakesegad__blossom__amaypranaysanjana yadavganga16trpari_goyalsweet-fairyTwilightStar_JP-Anu13-simi58Sona257kooltoaddeeswarnajakhushismansnoopy84riafnaroops82-Prithi-BlackHole...Iyla...sruthickaquagalEXPELLIARMUSA_BADr.AALUSLOLWAkondhiliEccentricaAkorshiChitraFFAYKHAN29LyssaPie.x-bumblebee-x.Dee_Jthulasi_arshiKalyaanifffan123Riima_Azraavandana.sagar

arshisarun123 Goldie

Joined: 20 October 2012
Posts: 1479

Posted: 05 June 2013 at 8:23am | IP Logged
res 4

Edited by arshisarun123 - 05 June 2013 at 8:23am

The following 2 member(s) liked the above post:


.x-bumblebee-x. IF-Sizzlerz

Joined: 06 November 2011
Posts: 19768

Posted: 05 June 2013 at 8:23am | IP Logged

 To be fond of dancing was a certain step towards falling in love Embarrassed

Jane Austin .. 
Yeahh .. Teri meri ..  Embarrassed.. The most hottest thing !! Noo, Whyy saiyu ..Why did he have to say sexy ?! .. I'm now picturing khushi & her shocked face if that actually happened on the show ..  LOL.. The way you describe their kisses .. aww .. i can feel the passion ..
I was hoping that she would attack aman .. LOL I love how both arnav and khushi want to do something but end up doing the complete opposite .. Both their hearts and brain are playing a weird game .. aha ..
I adore the other couples .. :P ..
Great update .. Big smileBig smile

Edited by .._sonii_.. - 17 June 2013 at 5:08am

The following 2 member(s) liked the above post:


vgedin IF-Dazzler

Joined: 26 August 2012
Posts: 4623

Posted: 05 June 2013 at 8:23am | IP Logged


Teri-Meri. Post Teri-Meri cloakroom Rabba Vey.The dream sequence Teri Meri naughty dress. A bare chested Arnav. A sexy Khushi. A super hot kiss. Now thats what I call a Maha Update. Aaand Saiyyu is back with a BANG! 

Thank you for your not so subtle jab the the non existence of Savita :D And the fact the verrry traditional Raizadas are surprisingly okay with blatant PDA apart from just the eye sex. 

The fake couple on their real sangeet had a very real make-out session. Break up plans are nowhere to be mentioned. Only an SQ competition. This has to be the best non-fake fake couple. 

This time again, Khushi kissed him. Oh, he's going to have SO much fun teasing her! And will she tell him she tricked him into dancing? Will he go all ASR when he finds out? 

Sooo many kostins. Only Saiyyu can answer. To answer that, update FAST! 

Maha Update was super duper awesome!

PS - Special mention for Aakash without the ji and Sexy with the ji :) 

PPS - I don't know La personally, but may I still say something? She has the sexiest ASR pictures for her DPs. One look at it and I am all.. Blushing

Edited by vgedin - 05 June 2013 at 9:38am

The following 10 member(s) liked the above post:


Kalyaani IF-Sizzlerz

Joined: 15 March 2012
Posts: 21399

Posted: 05 June 2013 at 8:24am | IP Logged
This is so cute, forget funny or whatever...this A&K will always have to do something or the other to outdo each other and that too in the matter of a very fake wedding. In memory of the sequence you like so much...this collage

Edited by Kalyaani - 10 June 2013 at 8:30am

The following 2 member(s) liked the above post:


crazymg.04 Goldie

Joined: 14 March 2012
Posts: 1000

Posted: 05 June 2013 at 8:27am | IP Logged

The following 1 member(s) liked the above post:


Go to top

Related Topics

  Topics Author Replies Views Last Post
ArhiSS: Innocence In Her Eyes NEW UPDATE pg 130

2 3 4 5 6 7 ... 133 134

Author: Dalmuthuya   Replies: 1071   Views: 105642

Dalmuthuya 1071 105642 19 February 2015 at 3:32am by tuli_jayee
ArHiSS:We were meant to be (completed)

2 3 4 5 6 7 ... 33 34

Author: --peehu--   Replies: 270   Views: 25698

--peehu-- 270 25698 12 February 2015 at 3:13am by neha_shah
Th#2 ArhiSS:Bang, Hug & Kisses **Completed**

2 3 4 5 6 7 ... 74 75

Author: vikadesigirl   Replies: 594   Views: 129830

vikadesigirl 594 129830 08 December 2014 at 9:24am by SanayaMyLIFE
Arhiss:Princess b'day gift for papa[epi:pg 29]

2 3 4 5 6 7 ... 36 37

Author: Rami92   Replies: 292   Views: 23344

Rami92 292 23344 12 April 2014 at 12:06pm by maaneetkimeet
ArHi SS|The Search for the Perfect Bride Thread 2

2 3 4 5 6 7 ... 146 147

Author: ..Naina..   Replies: 1171   Views: 115690

..Naina.. 1171 115690 23 January 2014 at 10:05pm by ..Naina..

Forum Quick Jump

Forum Category / Channels

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index