Fan Fictions



Post Reply New Post

Page 1 of 163

Page 1
Page   of 163
Page 2 Page 163




Joined: 16 January 2012

Posts: 28936

Posted: 05 June 2013 at 8:22am | IP Logged

No, I do not have a blog.

Edited by Rasgulla_sp - 17 November 2013 at 3:31am

The following 79 member(s) liked the above post:


Dear Guest, Being an unregistered member you are missing out on participating in the lively discussions happening on the topic "ArHiSS:AnApateAffair#4,Ch21,Pg124,(19/07)COMPLETED" in Fan Fictions forum. In addition you lose out on the fun interactions with fellow members and other member exclusive features that India-Forums has to offer. Join India's most popular discussion portal on Indian Entertainment. It's FREE and registration is effortless so JOIN NOW!




Joined: 16 January 2012

Posts: 28936

Posted: 05 June 2013 at 8:22am | IP Logged

No, I do not have a blog.

Edited by Rasgulla_sp - 17 November 2013 at 3:13am

The following 455 member(s) liked the above post:

sudumonck1985harini19sydyzil143anaviabhiShini.Shiva86mishimradhagauriJaneRochesterLovenallRain_droprithuparnakk10underground1crazy.kiya.reipkknd17shasunleo2205Coolio56khubsbanuradhathepelicanpra12_anarishigunjanabcdzshree_27Hope1007zenith_zzKhatijahhopalongawsomechokrisusanbonesNova555rdwsydsmile_n_laugh1sarunfantomchi94princessep13swathivasisthapriyankasan02noushirireetjbablublisaborni123ranius yadavgugguanu1017lazylad8-FauZichitrajayamaypranaysparikhAnvi2009smandevishreemarch2011aafanKittya_Cullensmileyhug7679RhysennsudhareddykdsubstanurocksAparameghaN0306arshiyanaLove_SALeenaRocksmsindevsumMaddy1270cool_tweetyHriju321emistryaycma98KishmishSamyxxRaadhiyaaa__blossom__TwilightStar_JPsimi58kinjalcp87cheval-DobByDoDgeR-xbeyondwordsxApoorvaraniswatim318DalmuthuyawonderblakesegadP4rveen12deep5128sushnapraseethaaaytmissmksamiraoSS88PhoenixTearsavcmydIronButterflykhushboo1234Snoowfalladhu11amus5Hawa1997kclovearshiaashi12ranogillhoney-sweety.Avanti.kondhiliTake_ThatEXPELLIARMUSyoga123aquagalsruthicknaughtymallu...Iyla...diyadivyakooltoadfffan123mints23deeswarnaJforChimpanzeechulbuli94daisydee425Srilathalollariafnasnoopy84opsyellowfrenzyychandana.sdennisdmenacelaksh65VYGA89gogumazafiHot.Pink.Heelspriasweetrini_katAmti4upixiegirlayshaomarlara3110roops82-memorable-melonieridizzzdebby_11jakhushisoapsudsshonagudiaAR_EternalLove-Prithi-Aisha1996AALUSLOLWAnishu_shorna-Xpress-Akorshishalini_sflowers4u-Cheeni--afsha-shaliSenorita Sanayakeenu_kkragvir.fanBigbang_GDLaxshaLOVEArshiMyra.nellySuchi.R-aparna-ajoopLyssaPiesarunsashasinghNewbiesoapfansilvia1999rkapoor1382Omorabotiseeta_naipsRami92thulasi_arshijas0308Kalyaanipup031chillyflutterlashesEccentricavandana.sagarasrcraze.Nightingale...chavvi16nikita_88MysticRiverdumasspvdmishti_17jtmbarun




Joined: 09 April 2012

Posts: 30942

Posted: 05 June 2013 at 8:23am | IP Logged

Meri Saiyu <3

Thank you thank you thank you for the dedication !!
And for all those things you have said about me ! This is like the best thing anybody has ever done for me ! You have no idea how special I felt when I read this !! 

And it is my privilege to know you !!

And I'm no Co-author to this story ...Credit goes to Saiyu, Saiyu and Saiyu only! 

And avcmyd a big Thank you to you for asking V to make the banner and thanks again for all the comments you leave for me on the thread! You make me feel so good :)
I really loved the gif Hug (though I have no idea who those guys were and what he was sayingTongue )

Thanks to all of you who mention me in their comments :)

Thanks V ...for the banner...Its awesome :)

Accha lagta hain Embarrassed



  Over to this update's Comment !                                           








Edited by asrcraze - 08 June 2013 at 8:21am

The following 87 member(s) liked the above post:

Rain_dropanamika00ArmelaseemaaryansangeethbalaSaRUNiansFOREVAarshifan91Sonia_J16sarun_nbPdrovercutiepie_ashsrithaAnne_ArHiARSHI_FAN11Paridhi7250anusha.nushKeenaraday_lilythebubblespop12anumadduriglimmernglittermrignayanismarty94khushiiXOXORandomGirlavantika_2012-Siaa-yusamAMAL722Hina69Shweta1691siamesecatAmiarismeluvbugdivyaarnavsrsrija.singh04celinawalterjg12SirenMitraammavedu80DivyahetA_BAP4rveen12SilentShadowSanaya.BarunHawa1997Maddy1270Kishmish__blossom__wonderblakesegad-Anu13-sanjana yadavganga16trpari_goyalsweet-fairyamaypranaysmansimi58TwilightStar_JPkooltoadfffan123Sona257deeswarnajakhushi-Prithi-roops82FAYKHAN29snoopy84riafna.Avanti.kondhili...Iyla...sruthickaquagalEXPELLIARMUSEccentricaSuchi.RLyssaPie.x-bumblebee-x.Akorshithulasi_arshiKalyaaniDee_JRiima_AzraaAALUSLOLWAvandana.sagar




Joined: 20 October 2012

Posts: 1341

Posted: 05 June 2013 at 8:23am | IP Logged
res 4

Edited by arshisarun123 - 05 June 2013 at 8:23am

The following 2 member(s) liked the above post:





Joined: 06 November 2011

Posts: 19480

Posted: 05 June 2013 at 8:23am | IP Logged

 To be fond of dancing was a certain step towards falling in love Embarrassed

Jane Austin .. 
Yeahh .. Teri meri ..  Embarrassed.. The most hottest thing !! Noo, Whyy saiyu ..Why did he have to say sexy ?! .. I'm now picturing khushi & her shocked face if that actually happened on the show ..  LOL.. The way you describe their kisses .. aww .. i can feel the passion ..
I was hoping that she would attack aman .. LOL I love how both arnav and khushi want to do something but end up doing the complete opposite .. Both their hearts and brain are playing a weird game .. aha ..
I adore the other couples .. :P ..
Great update .. Big smileBig smile

Edited by .._sonii_.. - 17 June 2013 at 5:08am

The following 2 member(s) liked the above post:





Joined: 26 August 2012

Posts: 4557

Posted: 05 June 2013 at 8:23am | IP Logged


Teri-Meri. Post Teri-Meri cloakroom Rabba Vey.The dream sequence Teri Meri naughty dress. A bare chested Arnav. A sexy Khushi. A super hot kiss. Now thats what I call a Maha Update. Aaand Saiyyu is back with a BANG! 

Thank you for your not so subtle jab the the non existence of Savita :D And the fact the verrry traditional Raizadas are surprisingly okay with blatant PDA apart from just the eye sex. 

The fake couple on their real sangeet had a very real make-out session. Break up plans are nowhere to be mentioned. Only an SQ competition. This has to be the best non-fake fake couple. 

This time again, Khushi kissed him. Oh, he's going to have SO much fun teasing her! And will she tell him she tricked him into dancing? Will he go all ASR when he finds out? 

Sooo many kostins. Only Saiyyu can answer. To answer that, update FAST! 

Maha Update was super duper awesome!

PS - Special mention for Aakash without the ji and Sexy with the ji :) 

PPS - I don't know La personally, but may I still say something? She has the sexiest ASR pictures for her DPs. One look at it and I am all.. Blushing

Edited by vgedin - 05 June 2013 at 9:38am

The following 10 member(s) liked the above post:





Joined: 15 March 2012

Posts: 20676

Posted: 05 June 2013 at 8:24am | IP Logged
This is so cute, forget funny or whatever...this A&K will always have to do something or the other to outdo each other and that too in the matter of a very fake wedding. In memory of the sequence you like so much...this collage

Edited by Kalyaani - 10 June 2013 at 8:30am

The following 2 member(s) liked the above post:



Senior Member


Joined: 14 March 2012

Posts: 992

Posted: 05 June 2013 at 8:27am | IP Logged

The following 1 member(s) liked the above post:


Post Reply New Post

Go to top

Related Topics

  Topics Topic Starter Replies Views Last Post
ArhiSS: Innocence In Her Eyes NEW UPDATE pg 130

2 3 4 5 6 7 ... 133 134

Dalmuthuya 1065 93760 19 July 2014 at 10:03am
By sabz105
Th#2 ArhiSS:Bang, Hug & Kisses **Completed**

2 3 4 5 6 7 ... 72 73

vikadesigirl 583 110933 15 May 2014 at 4:07am
By nehaswthrt
Arhiss:Princess b'day gift for papa[epi:pg 29]

2 3 4 5 6 7 ... 36 37

Rami92 292 20325 12 April 2014 at 12:06pm
By maaneetkimeet
ArHiSS:We were meant to be (completed)

2 3 4 5 6 7 ... 32 33

--peehu-- 261 15871 01 April 2014 at 3:52am
By Maghinalls
ArHi SS|The Search for the Perfect Bride Thread 2

2 3 4 5 6 7 ... 146 147

..Naina.. 1171 104323 23 January 2014 at 10:05pm
By ..Naina..

Forum Quick Jump

Forum Category

Active Forums

Limit search to this Forum only.


Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.