Iss Pyaar Ko Kya Naam Doon


Iss Pyaar Ko Kya Naam Doon
Iss Pyaar Ko Kya Naam Doon

~IssPyaarKoKyaNaamDoon? celebrates 2 years of Epicness~

beautiful. IF-Sizzlerz

Joined: 19 April 2011
Posts: 10665

Posted: 20 May 2013 at 6:35am | IP Logged
|The Page is VERY Heavy: let it load please|

We are here to celebrate IPK's second anniversary
A time to be nostalgic, but also a time to be merry
FFs, SSs, Oss of the show, can fill up a mini library
A show that gave us, our very own Tom and Jerry
The entry in a chopper became the best entry ever
He entered into a million hearts to stay there forever
The girl on a two-wheeler, dressed in her best attire
Entered into the man's heart, which was a big ball of fire
Sparks flew, tempers blew and challenges were made
Don't want to meet or talk, to each other they said
Like elastic, the more they pulled, the more they got closer
Like a magnet, everytime, they kept bumping into each other
Finally they overcame, their egos and their fights
They confessed that on each other, they always had rights
Arnav and Khushi are names that are taken in one breath
Together for a life long journey, these two are set
This was no ordinary love story, told in an ordinary manner
This was a deep-rooted tale, to unite two people forever
The show created such a craze, the numbers on everyone's fingertips
Everything had a count, from almosts and kisses, to falls and lifts
For many, this show has proved to be a boon
A show that's called 'Iss pyaar ko kya naam doon?'

After that wonderful poem by DurgaS, we don't have much words left besides stating the obvious.

Hello to one and to all!

This is Iss Pyaar Ko Kya Naam Doon's Second Anniversary Celebration Thread.

The many members who worked day and night to bring this to you guys are finally heaving a sigh of relief.

The preparations have been going on for the past one month now, and we would like to thank each and every one of those members for being a part of this.

The show that brought tears, joy and a smile on the many fans faces out there, this one is for you. We would be nothing but delighted to refresh some of those members.

This forum has had it's days when people were the happiest, and then there were days when there were fan wars, but putting all that aside at the end of the day and coming together. THAT'S the magic of Iss Pyaar Ko Kya Naam Doon? Big smile

So, congratulations, IPKKND and its members for still lurking around and being there for this great celebration.

Turn up the volume and enjoy the title track of IPKKND along with the most famous Rabba Ve.

Every forum is incomplete without the Development Team and same goes for this forum. There have been lots of ups and down but our DT was always there and they're still there! They visit the forum every day and do whatever they can to maintain peace by closing unnecessary topics, trying to solve problems raised by us and keep the forum active by bringing new contests, activities, games etc. They're loved by few people and not liked by others but still.. whatever people think and write about them, they continue to do the their job. IPKKND forum was the one forum that had a small DT which soon became larger than any other DT on India-Forums ever. 

Here we are with a short Interview of our DT: Saraa, Minuu and Mandy.

Here something we made for you guys! Embarrassed A small gift to Thank each of you for being there always! Hug
*By Sio & Viz*


Introduction: ~Saraa~ [Poem by: DurgaS]
Coffee with the DT: -Alina. , ~Saraa~, minuu & .Mandy.
Humari Kahani: ..SankiMedhz.. , lovelygal_sou & Sanaya.Barun
Sadasyay: Titaliya_AP &  ~Saraa~
Journey from Nafrat to Mohabbat: lovelygal_sou & crazy2012
ArHi on the Dance floor: -Mrinalini-
Pyar Key Rishtey: Titaliya_AP & ..hrideyy..
Khalnayak Hoon Main: _RheeluvsBarun_
Graphics: ~Saraa~, .sio.angel., -iLoveSobti-,  ipkknd_hazel,
 -chamkilli-, appy_indy-KD & sandy1

Special Thanks to the DT for approving this idea and helping, Titaliya_AP and ..SankiMedhz.. for helping a lot with the writings, -iLoveSobti- for animated banners and ...shruti... for the GIFs for the Nafrat to Mohbbat segment and the song conversion and the main title animated banner.

Edited by -Alina. - 06 June 2013 at 7:12am

The following 651 member(s) liked the above post:

kutumbrulzthanaletcumisindhunbrjs84brajenkaaj_2nanicutegalzleezauchuramanranisatv4sariaasvaskhubswyytmaaskunjalshahSuzich123Ask1ViRaLi13joyaamanaskrmajumderNadeeanuambzzzfildasMistumjayanmohanAstha_IFmbhandarianu97ipkkkbobocutepurple_ruleshakim218_arshi_Fluffy.Cattyanu6289..love_arshi..rahulroyalAysha_SarunAarYan23arshi__foreverSURABRADTanyaNRardentoldarshiaddictionneeveesravani11NEHASHAKYarshifanzZyloNilu50loony-toonysams521Nusratarshi-arshisarun-RaminluvsSarun9392367727jcchicagoSannyFansarshi14sanayagnmadhulovesrksaniiya.preetcyraChaanChaanMallika-e-SoapmrslaadgovernorBarunFan92ARSHIhameshaa94hina-khanbarunlover12ManrajTRudrigodadeviNakshatraWunscharhi-love17Twinkle.mahnoormalikAnjanaBharadwajAlinaPMMou_msjasleen14lovebarunasrnimkometaphor4CrazyDeesannabuttakashafalidreamsapphireanu41982ipkfan1aussiegal22lovebarun.ssanusnehaeshitamisrabhambarineethu01ammuimaria1878suyaSYGOvishavcutiepie123cupcake247goodluck1arnavcoolsp13esha85revathydileepBarundeewanidynamosabhayaamrtnitvijuKhushixoxoramsinikkipunjdimp72shivandhni..Zahra..tutu982Sarun_wahifananumadduriRSZRAR_ArShialishba45zeefan 1arshi_forever9Keenaragudia7jyot_pujaradiationshaheerdiwaniSpartan187Anu179serendipity235sib_12Ipkkndworldappletomypie-Emma.K-abayancecutivenikalovelygrlmukta3112sruthirishippa20KhushiiiiiiiSilver_Stacksaj111nimsnannuArshimaddydisheemeenasivanayaniArshi2gthr4evrAtyayAdoriMeyemoomibangleskitty789Hunnybunny3Arshiforever8sami99BlueOrchidsshruti_gurs_kkgsrnaadhira_khanFazzisarun.loveSarunAddictionpreity4lyfejennadriddzyeegirl_sweet22Iamyselffalak9090chanloves-JB_1Dgnainardforfunsumeeta-Delena-barunmaniacARHIFAIRYTALENgurudathashaileshjnarshi_roxSnellakanksha_aarshina223payalpencilkirthiarshimaria29eminictsnymdaafreen48OmkaraDeewaniDiakumar17Albalushitopez08soapoperaakleoawmpari97BARUNILU_ArshiSonia_J16JeeMaanipkviewerlovehappinessTess77ArHianSidYaliSanaya4SobtiNaughtyAngelarshifansangipkroseRainyDaysrosalinesibsitsme92sweetypie225d00dlepsymojosaithanmayeeChanyaforever.SmokeySilence.sandy_nivrenshane1SaRun.ArHi-Sruthi-shakethebiscuitMrManagementEnchanted_jassiMeridajenna_pniru273YPNHK_kiFANno.1yongshinsweet_5pollypollyTheGlamourgalzobshehinajnarixray358674swetha811BrokenHearts1D..Zenny..7_sneha_7joe_arhiana-twilightBecsTaujooMadihamaanasheanuzzbharogopikaajiMs.CheeniABCDesiGirl93TheDailyRushnancynairprabha75-Siaa-Lionscorpio..Kritz..ChickeeSarunIsBackgowrisameghnasPatatoTirtharupaLionessxoshreya09Baarish.-Inferno-chocodillaarshisarun123IpoonaI_Dont_KnowBarmeenForeverLovely_Bajwa_sugarhugskshows_fangirlvks11amri123..ipkkndsrija.singh04XBosyXDazeeVancouverBCdeepti1906ToulupPopo.deepzeeOlicity2124priyatnl.StunningSanz--BumbleBee--dimple288saucechipsjobisuhi.mahianamunirDornan_DeppKiekeboexoxo_BaruNiallsps1234BroknAngelChocolate_barunBarunKiRadhaGeoSjg12kunuarshiasya04ilovebieberBilliCat.Ramisaa-ARSHI-archie_79-HappyBird-DarlingSarun-Anks--sayeed-sweet-fairyCrazy_girl_15halleyiSakeenalazylad8-FauZiorpimelfnsquboolhai_1fan-Anu13-shilparoxxzainzaArHiLover-xnav_batCarpe_diem-Atiya-TANVI_SEXYdeeps.minnieefly_dogsreemeerahoopoesurita12BarunkidewaniArielIPKKNDfan4eversmiley-shineyBarunshellgo2sleep83.DivaDeluxe.ITS_LEENA..SSNAIR..segadarshiadvayHorizonArshi1195kiara86QuietlyLoud-solitary-zoharocksarnavkhushi22S111Breeeezyankitamishra201redroses123arnav4ever--Ritu--sk62BornToShipArShiaarrsshhiiAyie.DelReyAMNPKtotheMPastelBeautyanjaliipkkndKavya_sarunfairy_stardustSanzforSush--Sarunholic---.Pari.-Illuminati07ASRphankiA.Hajnalforever_youngDazzler.MaghinallsmbbsrocksSnoowfallGayurajAlai123Folla55kimsy5Crazy4Sobtikiminonawa-khaleesi-sweetsugar13basb..Sujith1001..darkmystery01MadhuO.Panache.shikha208dis_arshi-Anayah-YaGunnersYa.SpellofJoyAims.Parii..amus5wiwyRafahelinumber1serialAmeera.theloupgarouxvarsha2KDSpringPearlDarkDesire12Titaliya_APtiahalder-MissBoiiVamp-ohsehun...Breeze..vandana1965Forever19EXPELLIARMUSarshistar.GrangerMalfoy...Divya..blackdoveraniluvsasr-CrazySobtian-sruthickMADHU.BARUNnaughtymallumomo121-Farwa_Ibrahim-arnanyaSkiranArshig8ShikhaKhushimisscrazyfanSSB28crazy2012musicfan5CookieeMonsterKatelynLoveAsYa222arshi21207shikhamrym_rauf-sanika-PashbarunDeval__02INEFFABLEdiv26sana11cutebreezesaima4744stg1xMidnightStarxBarundeewani19jahnvi.luvs.ASRgms* Unnati *-CreativeSoul-applesauce.mythili2PutijaChalhovJyo.Arshi.IPK-Iruni-verisimilitudeSugarDream.nirvana.ll-Shilpa-llareeba_blossomMariaa.SG..Amira..ThanuAdityaChanna_mereyaaSK1991.Jazz.kiran_28seelaksViccoTurmericArjuhisisPoochiePieSonaLuvZaSaf-Muskii-FAYKHAN29.sweetchick.CATZ..Neloufer.ChitraFincandescentaish.chand1234pinky89Dhaakadlovelife.Deedeepa1Angel13VarunKiBiwiBerryBlush07silvia1999NazimKiDewani...Rapunzel...Hifahsummaiyasayed...OohLaLa.....SankiMedhz..Kesh123...Tanu...SrilathalollaNaz_nisarindi52Johny.S.Raj..ObliViate..susan7Mihrimah.Brooke.aartipartyyARS24candykrushFlora3333Rami92adithyanMamiaRehmanCrazyDeepssunitikapoorNazarLaayeNaa.Screwtape..SobtiLicious.GodhuliLogonshillu.arshiria1891happy_cupcakeAphrodite88LuvuKhushiBarun_Addictpup03Sharayu._Maggie_..Gunjan..angrybreadsweetly_sourIPK..Jennysoni19sweetdivsarunfan-Cutyeenidu-dsenaBarunAdmirerMesmerizingSanzsaritakDimaagKaKeeda-MitwaIshqPe-..SupreMe...Khamosh.-B.N.K-DEEPZzzzMoumimonvandana.sagartash10.MyriadOfHues.ArnieBoyBarunalonebirdshonasandy-chamkilli-IWishICouldArshi.Sugi.IPK-Koeli_Appy-DraculaGirl_SenbonZakura_DEFOM*Dev.*

..SankiMedhz.. IF-Sizzlerz

Joined: 25 February 2012
Posts: 13687

Posted: 20 May 2013 at 6:42am | IP Logged

A few important and outstanding tracks of the show that kept the pace of the moving. A few where we ooh and aah'd and a few that we all hated with a passion.

Iss Pyaar Ko Kya Naam Doon? - A story of two individuals who were miles apart from each other in thinking, status and everything. These two unique people were Arnav Singh Raizada and Khushi Kumari Gupta.

It all started when Khushi Kumari Gupta, middle class but a beautiful girl went to Sheesh Mahal but ended up on the ramp of a show held by Arnav Singh Raizada, the rich and arrogant business Tycoon.

She fell from the ramp while moving back nervously and before she could meet the floor, Arnav caught her in his arms. He misunderstood and closed her in a room but released her later. Khushi had to leave her city Lucknow after few days because of humiliation she faced when her video of show was released in media.

Fate dealt yet another hand in intertwining the destinies of Arnav and Khushi by bringing the latter as an employee to Arnav's company AR. An irate Arnav issues a challenge to Khushi ' to work under his conditions for 30 days, or to resign from the job. Not one to back down, Khushi accepts the challenge and manages to fulfill every task set to her, much to Arnav's surprise. In the course of various tasks, Arnav finds himself attracted towards Khushi. Confused by his emotions and Khushi's determination, Arnav sends her to a dilapidated building for her next task. However, Khushi ends up getting trapped within the ruins of the building and Arnav rescues her.

After the guest house incident, Khushi was asked by her family members to leave the job. Even she had decided the same, and gave the resignation letter directly to Arnav after venting out her anger for all the troubles he had caused her. Khushi wanted to help her parents in their financial crisis and had decided to go back to Lucknow.She also informed the same to Arnav. While her going back to Lucknow, an idea poped up in her brain and she decided to set up a sweet shop in Delhi itself so that she can help her parents. Destiny played the game once again,in which Khushi had received a huge order for sweets from Shantivan which was unknown to them.

Arnav brings home his girlfriend, Lavanya, to meet his family. However, a thoroughly displeased Nani tells Arnav that Lavanya will have to learn the ways of their family before she can accept her as a part of the family. Hence, Khushi is then given the task of helping Lavanya understand the ways of the Raizada family and in this process, Khushi and Lavanya end up becoming very good friends. Khushi tells Lavanya the importance of commitment and marriage in a relationship and convinces her to get married to Arnav rather than stay in a live-in relationship. This phase of the serial also saw Khushi experiencing her first 'Dhak-Dhak' moments in Arnav's presence and Khushi's relation with Arnav began to soften as they started to realize their attraction towards each other.

One of the most breath-taking tracks of the story, Diwali marked the start of attraction sparking between Arnav and Khushi. It was a period of skyrocketing heartbeats, quickened breathing, crackling chemistry as Arnav and Khushi came closer to each other. The highlight of this track was when Arnav gave into his feelings for Khushi after seeing her dressed in a red saree  '  his favorite color  '  on Diwali, resulting in an 'almost kiss'. However, the bliss was short lived. Aghast at his actions and perturbed by Khushi's questioning, Arnav decides to marry Lavanya  '  much to his family's happiness and Khushi's sadness. Another blow followed as Arnav told Khushi that she didn't matter to him in any way  -  thereby breaking Khushi's heart.

Owing to the pressure of family and her father's ill-health condition, Khushi got engaged to Shyam. After knowing the same, Arnav had shown his frustration and anger by announcing his will to marry Lavanya. He hurted Khushi by showing off his status and by continuously reminding her of her fiances financial status. He even asked Khushi to leave Shantivan as her job was completed. After a series of incidents, they both were not on talking terms. But once again, destiny brought them together to work unitedly for Payal-Akash marriage in which they were successful.

Khushi begins to find clues that make her suspicious about Anjali's husband's true identity. Despite her numerous attempts, Shyam manages to escape from Khushi's notice in the Raizada Mansion. However, through an unexpected visit to the Raizada Mansion for a puja, Khushi finally discovers Shyam is actually Anjali's husband and has been two timing her. Shocked and hurt, she confronts Shyam in the terrace and slaps him while letting him know that their engagement is now broken. Khushi tries to reveal to Anjali the true face of her husband, but certain events occur that make Khushi realize that Anjali isn't strong enough to handle such a massive blow to her relationships. Hence, she decides along with her family to keep this matter silent for a while.

Lavanya realized that Arnav was affected by Khushi and what she herself shared with him was not love, he never loved her. Arnav and Lavarnia decided to cancel their engagement and she left the house in hope that Arnav and Khushi would soon realise their love for each other.

Payal and Akash's wedding brought Arnav and Khushi to each other. Arnav felt jealous to see Khushi with NK, He cared for her when she fainted, he danced with her to erase the pain he saw in her eyes when she had no partner and the thought of Khushi's accident made him realize how much she matters  to him and he can never afford to lose her. Then the realization stuck him that what he did and felt was because he had fallen in love with her.

Arnav finally decided to confess his love to Khushi but what happened next changed their life. He saw Shyam hugging Khushi and saying that he loves her not Anjali. This lead him to the misunderstanding that Khushi and Shyam were having affair. He hated her for destroying his Di's life, who was the world to him. He married Khushi with a contract of 6 months to save his sister's married life. Khushi had to agreed when he threatened to break Payal's marriage but the reason for this marriage was unknown to her and she hated him to the core for playing with her life this way.

Khushi,unknown of the real reason for her marriage keeps on questioning Arnav. Arnav,who was under the impression of Khushi-Shyam affair,keeps hurting her and himself. In a series of events,even though they dont't share wife-husband relation,destiny kept bringing them closer and the misunderstanding, away from each other. Both of them love each other so much that the situations forced them to express their feelings but their ego held them back. Meanwhile, Shyam continued his plotting against them.

Frustrated with her strained equation with Arnav, Khushi decided to visit her family. Anjali and Nani insist on Arnav joining Khushi to visit in in-laws as well. Hence, Arnav begrudgingly accompanies Khushi to her 'maayka', where he faces various situations like power-cuts, water shortage and inquisitive neighbors ' but manages to pull through and win Khushi's family's hearts. In the midst of this, Khushi misunderstands Arnav and thinks he is planning to kill her in order to be with Lavanya. Khushi being Khushi ... decides to take herself out of the question by committing suicide. Arnav comes to know of the plans at the right moment and saves her from committing a folly and in the verbal battle that follows, Arnav reveals to Khushi the real reason he married her. Hearing Arnav's opinion about her character shatters Khushi, but she collects herself and continues being cheerful. During her friend's marriage functions, Arnav overhears Khushi tell her mother and her friends about how loving a husband he is and he feels momentarily guilty about snatching her tender dreams away from her.

Arnav hid the reason of their marriage from everyone and tried to show that he and Khushi loved each other. Not wanting to hurt the family, Khushi continued the act of a happily married couple in front of everyone.

The festival of colors. A festival, where the past is forgiven and forgotten…which is what happened as Arnav and Khushi's family finally forgave the duo for their runaway marriage – while still not knowing the real reason behind their marriage. Shyam's plans to apply color on Khushi were foiled as Arnav stopped him at the opportune moment. 'Bhaang,' a staple drink present at all Holi celebrations resulted in a drunk Khushi and Arnav expressing their true feelings to each other in a unique  and beautiful way. The effect of 'Bhaang'didn't last for long, though it lasted long enough for Shyam to finally figure out through Khushi the real reason why Arnav married her. Arnav seemed to remember the events that transpired during Holi, and it confused him regarding Khushi's feelings for him. Yet, it did not bring about a drastic change in their relationship.

Anjali, who had a clue about the tension between Arnav-Khushi, told Khushi the weakest point of Arnav-"The Love". She informed Khushi that Arnav always hated the love showered upon him but gets used to it in the long run. Khushi,waiting for the opportunity to irritate him, started calling him "Swami" and kept showering her love like a typical good wife by forcefully helping him in all his activities,cooking food for him which in turn made him angry. Irritated by her activities, he adressed her mentality as cheap which provoked her to take the decision of staying at Guptas House for a few days along with him.

When Arnav refused Nani for the honeymoon plan giving excuse of office, Anjali and Nani came up with a plan of "Bali in Delhi" and arranged their house as a hotel for honeymoon. Arnav-Khushi and Akash-Payal were sent to their decorated rooms after having a couple dance. Arnav threw away the burning matchstick when he was trying to lit the candle in their dark room and bed caught little fire. khushi panicked and threw a bucket of water on it causing the bed to get wet, this left them with no other option than to sleep together on a coach.

Khushi was shattered to know the real reason for Arnav marrying her forcefully. She tried many times to clarify her innocence but in vain as he believed his eyes. She wanted to prove her innocence to him with the help of Shyam and asked the latter to tell the truth. Shyam,who was waiting for the opportunity, tried to make a deal with her saying she should get the signatures of Arnav on some business papers after which he would tell the truth. Shyam also succeeded in exchanging the business papers with will just before Arnav signed them.Knowing the fact that Arnav was about to go to London. Khushi tried her best to prove herself innocent and also Arnav had given a chance for his love,as he hopes her to be innocent. Shyam succeeded in getting the will in his hands which were hidden by her and kidnapped Arnav.

Khushi was tensed to know that Arnav didn't reach London. Later got relieved hearing him safe but was shocked to hear the three magical words from him-"I LOVE U". She was sure that his life was in danger which pushed him to say these words and started investigating about his whereabouts.She was accompanied by Manorama mami.They together investigated the case getting hold of airport cctv footage.She suspected Shyam but he proved her wrong.She found the man who kidnapped Arnav but in the process of following him,gets kidnapped by him which led to meeting of Arnav.They both escaped from the place and ran away and took shelter in a hut at night.

In order to escape from the pursuing goons, Khushi and Arnav enter a hut to shelter for the night. Events follow such that Arnav and Khushi come closer to each other, but before things can progress further, Arnav realizes that the goons have surrounded the hut. In order to save Khushi from being captured, Arnav hides her within the hut and lets himself be recaptured by the goons. Khushi realizes what has happened the next morning, and on returning to Raizada Mansion she teams up with NK and works on obtaining information from Shyam regarding Arnav's whereabouts. On finding Arnav's location, Khushi rushes to save him, only to be intercepted by Shyam. In a bid to not let Khushi save Arnav, Shyam takes her away and binds her in the middle of the road. On the other hand, Arnav fights his way out from his captivity and rushes to save Khushi in an action packed sequence. Khushi in nearly killed in the process, and in an emotional scene, Arnav succeeds in reviving her. Together, they head back towards Raizada Mansion, their home.

Khushi finally decided to reveal Shyam's plan when everyone was questioning about Arnav's condition. Shyam being the clever man put all the blame on her saying that she and Payal are behind Raizada's money. NK supported Khushi and they both tried to show proofs but Shyam had already change and destroyed all proofs. With having nothing to prove, Khushi asked Arnav to look into her eyes and see that she's not lying. Arnav believed her and threw Shyam out of the house not before slaping him two times for hurting Anjali and Khushi.

Anjali continues to be morose following Shyam's departure from their house. Arnav and Khushi and everyone else try their best to cheer Anjali up and bring her out of her sorrow. In this process, Arnav and Khushi witness a growth in their relationship. They begin to try and understand each other, and give each other strength to move on and help everyone else in their family. This bliss was, however, short-lived. Following a breakdown from Anjali, Arnav takes out his frustration and helplessness on Khushi and accuses her of being the reason for all the problems in his life. He curses the day he met her and wishes otherwise'.which deals another blow to an already emotional Khushi. She realizes her presence in Raizada Mansion only seems to aggravate everyone around her, and in an attempt to keep up the peace, she decides to leave Arnav's house and go back to her own house.

Khushi tried to help out Anjali by suggesting her to forget the past and live for the future.Anjali,who was shattered,goes to the extent of trying to abort the child.When Arnav came to know that Khushi met Anjali,against the family wish,which provoked Anjali to do this, he vented out his anger on Khushi.In a fit of rage,he held her responsible for Shyam's disloyalty and Anjali's condition.Khushi decided to leave Shantivan but Arnav didn't want to lose her and on the pretext of marriage contract he made her stay back and warns her not to leave Shantivan.On the occassion of Khushi's birthday,Arnav arranged a surprise for her but when Anjali saw them,she misunderstands him.Khushi sensed the tension in Arnav-Anjali relation and leaves to Guptas House on the pretext of buaji's ill-health.She decided to saty there till the end of marriage contract.

Arnav realizes the extent to which he has hurt Khushi by his words. He vows to himself that he will bring Khushi back home before the 6 month clause ends  '  come what may. He sets out by cutting off the power supply at her house, which Khushi finds a solution to. Then Arnav buys Gupta House and threatens Khushi that unless she returns back to him, the house will be demolished. While Khushi refuses to bow down at once, she eventually gives in considering the fate of the rest of her family. A triumphant Arnav brings Khushi back to Raizada Mansion, hoping to woo her again and actually earn her love this time. Meanwhile, Anjali is seen meeting Shyam again, away from the eyes of the rest of the family.

Arnav's grandmother, Subhadra Dadi returns from an ashram and decides to stay at Raizada Mansion with the rest of her family. She immediately takes a disliking to Khushi and treats her with indifference. Arnav notices Dadi's cold attitude and stands up for Khushi the whole time. This infuriates Dadi and in a fight with Arnav, she brings up Arnav's painful past. Khushi tries to remain strong for her an Arnav's sake. Arnav's past is revealed ' Arnav's mother believed that his father was in an extra marital relation with another woman ' and hence commits suicide. Aghast at his actions, Arnav's father commits suicide as well '. leaving Anjali and Arnav orphaned. It is then revealed that Dadi is on Shyam's side ' and wants to bring him back into Raizada Mansion. Shyam however, hasn't changed his ways at all. His main aim still remains to get Arnav's property under his name, while his wife and his unborn child mean nothing to him.

Khushi realizes that she and Arnav were never married with all customs and rituals being followed and she refuses to move ahead with their relationship until they get married the right way. Unfortunately, Dadi gets to know this fact and creates a scene, thereby leaving Arnav with no choice but to get married to Khushi  '  properly this time. During the preparations, Dadi realizes that Garima is the woman who had been in a relationship with Arnav's father. She refuses to listen to Garima's pleas telling her that she hadn't know Arnav's father had been married at the time. Meanwhile, Arnav and Khushi remain blissful in their lives. They look forward to spending the rest of their lives together and promise to stand by and love each other  '  come what may. On the day of their Mehendi, disaster strikes as Shyam plots a way to kill his unborn child and thereby gain entrance into Raizada Mansion, much to everybody's anger. On the day before the marriage, Arnav and Khushi consummate their relationship. Fate, had other plans for Dadi revealed to Arnav Garima's secret on the day of his marriage. Aghast and shocked, Arnav doesn't arrive on at the mandap ' causing quite a scene. In the end however, Arnav decides to not let his past rule his future and returns to the mandap to marry Khushi, thereby foiling Dadi and Shyam's plans.

They were living happily when Arnav's ex-girlfriend came with a kid, Aarav. Aarav was just like Arnav in attitude, behavior and had same hobbies as Arnav. He also had diabetes. This made Khushi doubt that Aarav might be Arnav's son. She asked Sheetal to live with them till she get a house. Her doubt were confirmed when she asked Sheetal about and and Sheetal accepted that Arnav is Aarav's dad. Later Arnav proved that Sheetal was lying. Sheetal then opened up and said that she did this for money. Aarav, who was an orphan was adopted by Arnav and Khushi.

Khushi wanted to prove that she can do anything not only cooking and so she decided to participate in "Mrs.India Contest". She had the consent of all the family members except for Arnav as she wanted to give him a surprise. During the contest,Khushi-Arnav came face to face as he is the main sponsor of the contest.He told her not to take part in the contest as he felt she was too innocent for the cruel modelling world.she persuaded him and he gave her the consentto participate.She requested him not to reveal her identity as she wanted to create her own identity.With the unconditional love and support of Arnav,Khushi finally won the contest and was crowned Mrs.India thus proving her worthiness. This was featured in the last episode of the drama "Iss Pyaar Ko Kya Naam Doon...?".

Edited by ~Saraa~ - 01 June 2013 at 2:16pm

The following 346 member(s) liked the above post:

kutumbrulzbrajensariaasvaskunjalshahswyytmaasfildasvkiranmayi15ipkkkbobocutearshimaniahakim218ipkholic_arshi_Fluffy.CattyAysha_SarunSURABRADarshiaddictionharnisha1arshifanzNilu50Shreyah19loony-toonymanpreetkPiya157-arshisarun-9392367727jcchicagosarshi14Aishwaryaraotepyarabarunsobtisaniiya.ipkmiss1godadevibarunkidewaaniarhi-love17_IcePrincess_arnavkhushi398AnjanaBharadwajAlinaPMnimkoCrazyDeeakashafalianu41982aussiegal22neethu01eshitamisracupcake247goodluck1vishavarnavcoolamrthaskatieKhushixoxonikkipunjkashevrajvtacuriouscatKeenara-tardisblue-zeefan 1mukta3112sruthirishiday_lilycutivenikayush-swtsaj111outland_123Arshi2gthr4evrAtyaymoomiHunnybunny3chanloves-JB_1DFazzipreity4lyfegirl_sweet22Iamyselfsarun23riddzyeeArshiforever8sumeetaARHIFAIRYTALEsheenalipkkndbarunmaniacpayalpencilHarshi.IPKaafreen48pari97OmkaraDeewaniBARUNILU_ArshiSonia_J16ipkviewerarshifansangJeeMaanipkroseRainyDaysrosalinesibssweetypie225psymojo.SmokeySilence.shane1SarunIsBackmeghnasTheGlamourgal358674inajnaryongshinpollypollyVancouverBCsanaya_parisrija.singh04ToulupXBosyXHanalitaxoxo_BaruNiallsps1234StunningSanzswetha811BrokenHearts1Danamunir7_sneha_7ana-twilightjoe_arhibharoprabha75PatatoN33MAABCDesiGirl93BarunKiRadhaCanadianChikChocolate_barunkunuarshi-Inferno-chocodillaIpoonaI_Dont_KnowVIRMANbestBarmeenForeverkshows_fangirlvks11amri123..ipkknd-ILoveSaRun-Ashi3ASRphankiA.HajnalDazzler.Maghinallsforever_youngSnoowfallSanaya.BarunAlai123sreemeeraIPKKNDfan4everBarunshellminnieesmiley-shineyhoopoesurita12Arshi1195QuietlyLoudITS_LEENAmelihoneyarshiadvayKtotheMaarrsshhiiBreeeezy-solitary-sk62BornToShipArShiAyie.DelReyPastelBeautyanjaliipkkndfairy_stardust..Sruthi..melfnsquboolhai_1faniSakeenaDarlingSarunsweet-fairy-Anu13-Ramisaa-HappyBird--Anks--sayeed-TANVI_SEXYnav_batzainzasamin6Carpe_diemmasaf59-EndlessSmile--GredForge-Alyaa_27fan145Sidda8meniranjana00ayshaomar--Fairy--win7kupkakeszooni.bluepisces25_NiShI_aamir18Vidya_luv_SaRunUltimateBarunOmaRamdassBarishkiduaamomo121blackdoveSkiransruthickMADHU.BARUNmrym_raufSSB28KatelynCookieeMonstercrazy2012misscrazyfanxMidnightStarxBarundeewani19jahnvi.luvs.ASRMani.raizadaINEFFABLEsaima4744lalarukh-Aswathy-KranuLivingInPajamasParii..MadhuO.Panache.darkmystery01wiwyRafahelidis_arshiYaGunnersYa.SpellofJoyTitaliya_AP-MissBoiiVamp-number1serialAmeera.varsha2KDohsehun.vandana1965arnanyaSpringPearlsweetsugar13deepz_SI.BS.PastelDamsel..Mandy.MastMalangjeb1pinky_blueskies-purnima-areeba_blossom..Amira..-CreativeSoul-verisimilitudeSugarDream-Iruni-muffins2waffles-Sonali-.Saraa.Jyo.Arshi.IPKPutijaChalhovpinky89incandescentChitraFbeautiful.PoochiePieSK1991.Jazz.NazimKiDewanisilvia1999lovelife.Deedeepa1Angel13spoorthi.sweetchick.VarunKiBiwiFAYKHAN29CATZ.....OohLaLa...HifahsummaiyasayedJohny.S.Raj..ObliViate..Rami92Flora3333adithyan.Brooke.candykrushNaz_nisarseeta_naipsSrilathalolla.Screwtape..SobtiLicious.thulasi_arshisunitikapoorhappy_cupcakeMysticaldivineAphrodite88GodhuliLogonnidu-dsenaMesmerizingSanzSharayu._Maggie_Barun_Addictpup03IPK..Jennyangrybread-Cutyee.Khamosh.DEEPZzzzMoumimontash10.MyriadOfHues.ArnieBoyBarunalonebirdxAaliyaNestleToulouseDEFOM-Koeli_Appy-Arshi.Sugi.IPKsomergasm.Roshini1494-Deepali-ara_000.AnJaNa.mishti_17_Divya_ragzz.-Mrinalini-riti4uzohakhan7princessunaradumasilluminated.sunaina02khushixJennyPennyspvd.Leprechaun.Sano88

Titaliya_AP IF-Rockerz

Joined: 05 October 2012
Posts: 5499

Posted: 20 May 2013 at 11:48am | IP Logged

Without whom Iss Pyaar Ko Kya Naam Doon wouldn't have been possible. Here's a little dedication in a poetic way to the cast which stood out and made this a possible and epic venture.

Unrelenting, strange and full of contrasts.

He is often egoistic, aggressive yet noble.

His unexpected reactions and his unlimited ambition make him who he is.

A difficult and uncommon partner, someone who is not always liked, as he seeks solitude.

Is often admired for his ingenuity.

An unimaginable hate lives within him, he likes to play with fate.

Although a jealous and passionate person.

Of slight build, charming, beauty, and a sweet tooth.

Carries a pleasant aura, adventurous yet sensitive.

She can love anything or anyone, but self-dignified.

Full of talents, very generous and selfless.

Has a desire to love and to be loved, shies away from loneliness.

Her life is today, puts behind the past with no worries about tomorrow.

Although a child-women, a carefree person with imagination.


Cheerful, kind, and full of love.

A honest and noble partner, who worships the one she loves.

Of pleasant shape, tasteful clothes, and modest demands.

She is gifted sans the ego and anger.

Both dependent and independent, ruled by emotions.

An ingenious strategist, few friends and many foes.

Evil and dangerous, a destructive combo.

He'll have your heart at the flick of his sweet tongue.

Ruled by his love, a hunger for money.

His pedantic nature made and ruined him.

He is reasonable, balanced, tolerant yet cheerful.

Avoids aggression and violence, but loyal.

Full of warmth, sensitivity and kindness.

Enjoys agreeable company, quiet in nature.

Can be a capricious lover, but honest.

She is unpretentious, modest yet attractive and friendly.

Does not like anything in excess.

Abhors the vulgar and loves like in nature and in calm.

Not very passionate yet loves truly.

Creates a calm and content atmosphere.

Lovely, dignified, and sophisticated.

Stern ideals about life yet soft and relenting.

Keeps her feet on the ground despite their wealth.

Cares for her loved ones as a mother figure.

She is of a balanced nature.

Concerned about her looks, materialistic on the outside.

Keen on keeping fit, pretentious.

Self-willed, but sometimes nervous, full of complexities.

But becomes an anchor when needed.

Behind the mask of makeup is a mother's heart.

Nothing like Mahendra Singh Dhoni is MSR.

He went missing for too long with his wife not mentioning him either.

His driving is considered the best though!

Uncommonly attractive, vivacious, impulsive.

Demanding yet ambitious and intelligent.

With an air of sophistication.

Does not care for criticism, can be egoistic.

Brains rule over heart sometimes, but a faithful and prudent lover.

He's charming, undemanding, and very understanding.

Knows how to make an impression.

Loves the sun, warmth, and kind feelings.

Reliable in any situation, an anchoring partner.

Loves everything about life and full of healthy optimism.

Accepts what life dishes out in a composed way.

Hates to fight yet will for his family.

Calm with a well-developed sense of justice.

Impaired, but not one to give in easily.

He is very empathetic and carries a good intuition.

Shy and reserved, not very self-confident.

Only courageous when it comes to her dear ones.

Carries an immense love and burden.

She is a faithful and tender partner, mother.

Fate has played it's game, yet she stands tall in the end.

Very unrelenting and choosy, no contradictions or arguments.

But is filled with the love and care enough for hundreds.

Not in the least bit shy, full of impatience.

Content, adaptable, and strong.

Of modest demands and love for her family.

Everything disappoints till she finds it ideal.

Despises laziness and idleness.

Doesn't like anything in the excess.

Likes to make decisions for others, calculative.

Unsympathetic, brings pain and past like a storm.

The NRI, mother of supposed Arnav's son.

The character that was supposed to break Arnav-Khushi.

But oh what a fail that was.

Looks like a mini ASR, acts like one too, but seldom loud and rowdy.

Is often lonely, has great animosity yet is artistic in nature.

Craves goodwill and pleasant surroundings.

But irritates easily and sensitive in company.

Cute and funny, but full of melancholy.

The kid who was loathed by one and all.

Whereas, kids bring two people together,

Bubbly was nothing like it at all.

The goat that grabbed the audience's attention.

She was loved by the main lead.

Everyone felt the love when she'd listen to Khushi's rants.

The poor brothers who did nothing but were still the ones yelled for.

There was a whole family.

Referred to as; OP, HP, IP and MP.

Edited by ~Saraa~ - 02 June 2013 at 2:17am

The following 287 member(s) liked the above post:

kutumbrulzharshiyataanusariaaViRaLi13Prabhasatyajithyasminraizadavkiranmayi15ipkkkbobocuteipkholicFluffy.CattyAysha_SarunSURABRADarshiaddictionNilu50manpreetksaniiya.Mallika-e-Soaparhi-love17_IcePrincess_AnjanaBharadwajAlinaPMnimkoakashafalianu41982neethu01eshitamisrarevathydileeparnavcoolgoodluck1vishavKhushixoxokashev..Zahra..hillyzeefan 1pallavisarkarsruthirishicutivenikasaj111banglesoutland_1233RidHiipkkndak3Hunnybunny3AtyayArshi2gthr4evrmoomiFazzisumeetagirl_sweet22Iamyselfsarun23riddzyeeArshiforever8payalpencilARHIFAIRYTALEbarunmaniacsamaz95Harshi.IPKaafreen48pari97BARUNILU_ArshiarshifansangRainyDaysSonia_J16JeeMaansweetypie225OmkaraDeewaniChanyaforeverBarunKiRadhatanvi_arshiBarmeenForever-Inferno-tragedyamri123XBosyXVancouverBC..ipkkndsrija.singh04xoxo_BaruNiallStunningSanzHanalitakasaf_ZGHswetha811BrokenHearts1D7_sneha_7ana-twilightjoe_arhiprabha75N33MAABCDesiGirl93meghnasshane1pollypollyTheGlamourgal358674inajnarBilliCat.-Anks--sayeed-DarlingSarun-Anu13-sweet-fairy-HappyBird-melfnsiSakeenaTANVI_SEXYdeeps.nav_batzainzaCarpe_diemsamin6-FelixFelicis-fly_dogsmiley-shineyBarunkidewanisreemeeraminnieeIPKKNDfan4everBarunshellhoopoesurita12ITS_LEENAQuietlyLoudarshiadvaymelihoneyPastelBeautyaarrsshhiiAyie.DelReyBreeeezy-solitary---Ritu--sk62BornToShipArShifairy_stardustA.Hajnaltvbug2011..Sruthi..anjaliipkkndforever_youngAshi3Alai123SnoowfallDazzler.Folla55aleena.1884.Panache.deepz_SI.BSsweetsugar13RafaheliwiwyParii..-Anayah-varsha2KDnumber1serialAmeera.SpringPearl-MissBoiiVamp-sruthickMADHU.BARUNnaughtymalluarnanyaohsehun.

.m.a.r.y.s.i.o. IF-Sizzlerz

BollyCurry Assistant Writer
Joined: 18 February 2010
Posts: 14604

Posted: 21 May 2013 at 7:42am | IP Logged

This is a special segment where the team has put together the scenes of Arnav-Khushi from Nafrat to Mohabbat. To outline and encase, how their love was constant and epic!

This scene was in the very episode of IPKKND where Arnav is angry and breaks the pearls necklace that Khushi has. He yanks it off her neck. Soon after he actually falls for Khushi, he gives her the pearls again and gives her the happiness like she had always wanted.

Khushi thought him as emotionless man whose heart had been mistakenly replaced by a piece of stone by GOD. But, later she found her heart beat went uncontrollable when she got to see him, perhaps roaming around. But later, both heartbeat became same, his heart says nothing but "Khushi"

He loved her, cared for her, but his ego could not let him to tell this. When he did not get her phone, he became anxious, when the piece of broken bangle hurt her, this made him unrest, and still he claimed "Koi Farak Nahi Padta". Khusi goes to Airport to stop her husband going far from her, every small thing matters a lot her as Arnav is her Husband.

Even though Arnav knows that Khushi's presence has an effect on him from the beginning, he never gives in for the same. He always says that her presence meant nothing for him thus hurting her very badly. When Arnav comes to know of Khushi's engagement, he declares his will to marry Lavanya all of a sudden just to show the same-"Tumhare hone ye na hone se mujhe koi farak nahi padta".His egoistic nature never allowed him to accept the fact. But in their beautiful journey of love, the real Arnav is brought forward and he comes a long way to express the same in the farm house saying-"Main tumhare bina jee nahi paunga." This itself shows how he changed because of love n for his love.

Even though Arnav is aware of his feelings for Khushi, his egoistic nature made him to hide them up and force himself to stay away from her thoughts. In this process, whenever he feels that her presence is affecting him, he keeps shouting at her asking to leave from his life-"Nikal jao meri zindagi se". But after accepting his feelings for Khushi, and in the journey of their love, Arnav realizes the importance of her presence in his life. When he is undergoing an emotional turmoil during his sister's miscarriage, he wanted her by his side and he didn't hesitate to say so-"Mat Jao." This shows his complete transformation in trust and love.

Anjali said Arnav to bring Khushi with him while returning from Payal's house. Khushi didn't trust him as he always kept shouting on her, left her alone in the midway, and told her to get down from the car as per his wish as the car belonged to him. He did it, Khushi was right indeed. Later, he left her when she went to Bua Jee's place or whenever she wished to go anywhere. She became the invisible owner of his car's front seat just beside him.

It was Payal's wedding where her sister, Khushi dressed beautifully with a red ghagra choli. But who knew then, Arnav Singh Raizada held her roughly and dragged her to the Mandir to marry her forcefully for the six months only. This was against her wish; she even didn't know the actual reason behind it. Later, when the two again was going to bond with the holy spirit of marriage, Arnav became mesmerized with the divine beauty of her bride, Khushi who was waiting for him in the Mandap.

During Payal-Akash Haldi ceremony, Arnav is irritated at the sight of Haldi. When Anjali tries to put Haldi he backs out but finally she succeeds in doing so. When he comes face to face with Khushi, and she laughs at him seeing Haldi, he just wipes it off with her dupatta. But when he is completely in love with her, during their own Haldi ceremony,he is seen as the most happiest person in the world enjoying the Haldi function. He allowed everyone to apply Haldi on him. And the ultimate change is the person who wiped off the Haldi, now applies his Haldi to Khushi by caressing his cheeks to hers.

She held the collar of her husband, but felt embarrassed at the same time, when Arnav came to see Khushi's Buaji's house. He gave her the authority as she was his Wife, "Patni ho tum meri..Haq Hai..Mujhpe", very true - Khushi had every single right on Arnav's life. Later she realized her haq on Arnav so well when she came to the bachelor's party of Arnav. She told her husband if anyone tried to come in between, she would not let her go alive.

She used to sing her unique song to irritate her Laad Governor - when she was washing clothes at his personal swimming pool or when her husband was dropping her at her mother's place or when she was cooking something for him. But later, when this tune bonded Arnav's heart with Khushi's, it played the same tune.

From the time Arnav Khushi met,whenever he takes a step forward she takes a step backward.This continued for a long time.After all the misunderstandings were cleared,Arnav tells Khushi that it's time for her to stop going backward instead she should step along with him.Later on,Khushi makes an attempt for this where we see that she tries to stand still in a place when Arnav steps forward and comes near her.Further love changes them to an extent that when Khushi is angry and tries to vent out her anger on him,and comes forward he steps backward.This shows their transition in love. Arnav who always believes stepping forward leaving others behind wants his love to step with him and then he even steps back to let his love come forward.

Every time he held her arms, it made her hurt, his arrogance, ego could let him to hurt her always, but it was the pain of love - they didn't realize. But when Arnav realize that his life was incomplete without that simple girl Khushi, he urged to get her closure, his internal feeling of heart for her changed and he took her wife, girlfriend with the touch of petal.

Khushi always, either trips and falls down or hits against something or the other. Arnav holds her several times from falling and from hitting against the door and other things. Apart from saving her, he always says- "Khud Ko Sambhalna Sikho" which leaves Khushi completely speechless and perplexed. As their journey of love continues, there comes a point where he saves her without any complaint and she asks him to do so and he replies that he will do it forever-"Hamesha Sambhalunga." This shows their personality transition in love.

Khushi undergoes an emotional turmoil when her father suffers from heart attack. She feels all alone in the hospital. When Arnav comes to meet her, Khushi at the sight of him just goes running and hugs him relieving herself from pain and loneliness. Arnav just stands still without even comforting her. After a lots of ups and downs in their journey, there comes a point when kidnapped Arnav meets Khushi and when she runs into his arms, he hugs her back as if it's the world for him. He also comes to a point where he himself goes forward and hugs her.

When Khushi's dupatta gets stuck to Arnav's car mirror,he didn't care to remove it and give it back instead he ripped it off showing his cold heart which hurted her very badly.There comes a point in their life,when the goons pushes Khushi off the cliff her dupatta falls down.After he saves her,he takes the dupatta and wraps it around her with utmost care.Love has changed him from beast to prince in Khushi's words.

In the office track, when Arnav steps forward Khushi goes back and trips. When she is about to fall he catches hold of her hand. He asks her whether she wants him to save her or leave the hand. She replies saying that she would be happy if he leaves her hand rather than saving her. Without any hesitation, he leaves her hand and she falls down. After the hate marriage, immediately after the Heer-Ranjha play, there goes an of argument between them. In between,she is about to fall from the steps but he catches hold of her hand. She asks him to leave her. Initially, he tries to leave it but finally he just pulls her back thus saving her which leaves her perplexed. This shows the importance of Khushi in Arnav's life. Even though he says he hates her, he loves her.

Her heart started beating when she goes to him, it might be her acidity for fasting during Navaratri puja, she consoled herself. It started beating with a bang once again when Arnav took Khushi on his lap, they found their two hearts became inseparable, it beat together forever.

This shows how their love was unconditional. Khushi had initially asked Arnav not to leave because she could sense that something was about to be wrong. Arnav repeats the same words again "mat jaao." Both said in times of need, when they needed each other to stick by and not go.

The transition in Arnav's character was very vital for IPKKND. How Arnav in the beginning couldn't even confess that he cares for Khushi, later changed into Arnav blurting it out time and again without any hesitation that he loved her. His words were "I love you dammit" that were quite famous and meant a lot more to Khushi than a usual "I love you" would have been.

Edited by ~Saraa~ - 05 June 2013 at 6:54am

The following 250 member(s) liked the above post:


-Mrinalini- IF-Stunnerz

Joined: 22 August 2010
Posts: 30295

Posted: 21 May 2013 at 8:30am | IP Logged

Arnav and Khushi were seen either on the dance floor or there were songs that meant something completely different to the ArHi fans once they were used as background score for ArHi. Here's a trip down the road to some of the outstanding songs that changed the ArHi world.

Different as chalk and cheese, they entered the mazaar together.

One who had faith and the other who did not!

The walked through along either sides of the mannat ki chaadar.

Unknown to each other, what life had in hold for them next!

She crossed his path as the breeze made her dupatta caress his stern face.

The peacock feathers touched their head as Allah's blessings.

She took them with a sweet smile and he shrugged them off.

She prayed as she tied the holy thread praying for happiness, just like her name!

Unknown to her was the person she cursed, stood at the other side tying the thread.

This unknown co-incidence was the first step together in life.

What did they know that this hatred would evolve into a lifetime of togetherness?

Their presence was known as the breeze played along, they looked over at each other.

A strong attraction pulled them to each other as they tried to repel.

Unknown Feelings filled their hearts as they walked along on opposites end of the decorated hall on diwali night.

The spied at each other silently, wanting to talk to each other.

Later she sat by the poolside lighting the diyas.

She heard him call her and sprang up in shock only to twist her ankle.

He helped her onto the recliner and tried to help her out.

She was sceptical still unknown to the bond between them.

He held her soft feet on his knees, she clutched onto him due to pain.

He cured her sprain in matter of seconds as she looked at him in amazement.

He picked out her amma's lost payal from his coat pocket and fastened it round her ankle.

They broke apart confused and walked away.

Still could not part as he turned to her and walked with desires in his eyes.

He blocked her onto the wall and caressed her cheek as she shuddered.

He cupped her face to taste her soft petal lips but destiny had other plans.

The genda phool hit him on his face while he chatted with his clients.

He looked at the direction from where it came and saw her grinning at him.

The family gave a shocked expression, waiting for the expected from him.

She played with the catapult as she smirked at him in victory.

Flabbergasted he was as she winked at him and sang the song.

There came a duplicate him, dressed up just like him.

His eyes popped out in shock, as she mocked him throughout the dance.

The audience scared to know his reaction as he stood there still looking over at the dance.

A few knew that he would shout and bark in anger but then happened the unexpected.

He laughed along at his mockery and the audience stood stunned.

Shocked to see him smile and laugh, the family came around and teased him.

He didn't bother much as he saw her smiling face which inturn made him smile once again!

She was lost, unhappy to be loosing the bet to him.

But the breeze played along as he stood right in front of her.

He said sweet things which were unexpected.

He held her with pure passion and desire, as though she were a brittle glass doll.

He could do anything to wipe off those teary eyes.

Unknown feelings built up in them as they twirled and swayed.

He caressed her soft skin making her gasp. She shuddered when he held her tight.

The words of the song felt so true, as if they were describing their own lives.

They were lost in each other, lost in the touch of love.

The applause brought them out of trance making them realize something.

Something that they weren't able to name.. But that day their bond strengthened.

A forced honeymoon indeed, the family had brought honeymoon to their home.

They wanted the newlyweds to spend some quality time.

The couples were made to dance; one who did willingly and the other were forced.

She placed her hand gently on his as her held it and pulled her to him.

They swayed and twirled unwillingly but they knew they wanted this moment.

He looked over her shoulder to see the evil eyes glued to his wife.

Passion took over that moment because she was only his.

He held her possessively and danced with her.

They twirled and swayed in the moment of aggression and passion.

He pulled her to himself possessively and grabbed her waist.

The onlookers applauded as they broke apart and looked into each other's eyes.

Months ago, an enchanted confession had to be done.

The stage was set, lovers were ready to confess their heart.

The moon was ready to shine more brightly, to make the world see that beautiful confession.

But their destiny had some other plans.

Clouds came, covered the beauty of moon light and in seconds, everything was devastated.

Months later, living in love-hate relationship, he finally spoke those 3 magical words, which her ears were begging to hear.

Those words echoed and shuddered her soul with happiness.

She saw her prince back home with her, living the fairytale life.

He gave her gift, they talked and laughed.

They loved each other beyond words.

But then it was all a dream, the dream that she treasured hoping her love was safe and sound.

They looked over talking to each other through the stars.

He saw her standing there standing right in front of him with a smile.

The fairy lights shimmering and the moon lit sky.

He saw her walk closer where he grabbed her waist and pulled her into him.

He broke apart and walked to her back gently sneaking his arms around her bare waist.

It made her shudder, It made her blush. He had her in his arms right there.

She turned to look at him and raised her palms onto his stubble cheek.

She gazed and walked away from him.

Their eyes had desires for each other; a feeling of longing together.

He walked over to her and cupped her cheeks only to realize it was his dream.

She ran over and hugged him from behind pouring in all the love she had.

He held her hand and turned to hug her.

She was all he wanted.. But what could he have done if it were just a dream?

It was the best day of their life, they found each other!

All they wanted was to be together.

The past dreadful days were finally fading away, their love waiting to be confessed.

They ran for their lives into the forest and took shelter in an old cottage.

Their eyes held passion and desire; the pure love that they had for one another.

He saw her in white, looking like an angel fallen from the heavens.

He closed in on her to pick her up in his strong arms.

The hay bed waited for the lovebirds to become one for eternity.

She shuddered on his touch in pure ecstasy.

The night to be remembered was just a moment.. the moment which was broken!

The dark clouds covered the rainbow as it was time for them to separate again..

Separate again only to be Reunited!

His past haunted him so bad and the nightmares gave him sleepless nights.

He stood at the poolside gazing at the gleaming water.

She stood behind, unknown to him; thinking of ways to reduce his pain.

She wanted to share his thoughts, thus picked up her phone and played the song.

The melody made him turn and look at her in confusion.

She looked up at his worried face and gave a sweet smile.

The libretto made him avoid her, but she made her way to him.

He ignored her all the while as she tried to cheer him up.

She smiled and hugged him only to be shrugged off.

His pain was crystal in his orbs and her only goal was to let him free of it.

A bed of roses awaited her as her prince had wanted to show his love.

The old days were to be forgotten to start a fresh.

She came out in red fearing the moment in a dress that he had gifted.

He stood there looking at her, holding the dupatta.

His orbs gazing at her beautiful moon like face.

She stood in a corner shivering as he walked to and turned her to face him.

He gently held her hand and took her need the bed, draped the duppatta over her head.

The color of love covered the room, as he waited to make her his forever.

He hugged her slowly pulling her into him assuring her that he was hers and she was his for eternity!

The family danced along in happiness of two souls uniting in holy matrimony.

The gleaming faces of the much in love bride and groom was a sight of awe.

She clapped along as he watched her with eager eyes.

They gazed at each other for a while.

He walked over and nuzzled in her ear sweet nothings.

As the little man came along and made his bhabhi dance, she danced trailing her fingers on his face.

She praised herself and questioned him her fault.

He walked to her not breaking the eye lock and pulled her to himself.

The eyes did the talking and she gently placed her palm over his heart.

He hugged her with all his might making a promise of a lifetime.

They sat in the hall watching the sangeet function.

Family enacted as they relived the past few months.

From the day they met to the day they fell in love, they smiled to each other.

He saw her clap her hands in excitement and smiled.

He looked back to the stage and dreamt of dancing with her.

He danced and swayed along with his love in his arms.

The thought was broken as he looked at her.

Her gleaming eyes were mirroring her emotions for a future together forever!

As the light beamed again, through the group of men came her Prince.

She was shocked and surprised all together to see him ready to dance for her.

Her love already knew how much she loved her "Salmanji"!

What could have been better than proposing her in the Khan style! 

The family had never seen him so happy before that very moment.

Through the series of surprises, came another surprise.

He willingly did the famous 'Towel Dance' for her.

She gleamed with utmost happiness as she saw her prince dance only for her smile.

He finally sat down on his knees and whispered, "Will you marry me?"

She rose him up and accepted his proposal yet again!

He kissed her knuckles and as the couple hugged each other.

The audience rose to honour this special couple as tears welled up their eyes.

As the duo got lost in each other's embrace full of warmth, passion and pure love,

The family danced around them, rejoicing... celebrating their love!

Have a bachelor's party sweetly had she said, yet now she's crashing it.

Dance for me he dared, knowing she couldn't do it.

But then... The lights dimmed, the sound of anklets tinkled in the air.

He sat up, a slow smile forming on his lips as she sat on the floor with a veil.

He saw her hit the play button to which smiled in amazement.

She sang along with her acts to seduce him.

She tripped here, she tripped there and landed in his arms.

The seduction was fun-filled as he smirked seeing his innocent wife turn into a seductress.

He laughed over as she turned back into the bubbly kid dancing to the tune.

She held her excitement and pulled him into her as they landed on bed one over the other.

A smile adorning their faces and eyes full of love!

Food here, food there.. She came to the poolside to look out for the moon.

Her tummy growled in hunger as she frowned at the sky.

He smiled at his cute adorable lady love and wanted to cheer her up.

She told him to bring the moon for her.

But he showed her reflection in the gleaming water.

Indeed she was prettier than the moon!

She blushed at her reflection as he gazed at her smiling face.

He turned her to him and raised her hand to kiss her knuckles.

Love oozed out from his eyes, the respect he had for her as well!

He held her from behind, swaying slowly to the breeze.

His breathe fanned her nape, she shuddered and moved apart.

He pulled her back into him to sway and she smiled in contentment.

He twirled and lifted her, gradually brought her down, moulding her into him.

He looked at her with eyes full of desire.

A want to love her, a want to be loved!

She crashed herself into his hard chest whispering what the day meant to her.

What he meant to her!

Edited by ~Saraa~ - 31 May 2013 at 2:11pm

The following 200 member(s) liked the above post:


-Koeli_Appy- IF-Stunnerz

Guardian of CC, FF Graphicer Head
Joined: 19 January 2012
Posts: 26402

Posted: 21 May 2013 at 11:17am | IP Logged

The relations in Iss Pyaar Ko Kya Naam Doon that taught us something or the other. Be it loving the other person, or changing them into being a better person, these relations had a representation to them.

1) "If you have a sister and she dies, do you stop saying you have one? Or are you always a sister, even when the other half of the equation is gone?" - My Sister's Keeper.

2) "Of two sisters one is always the watcher, one the dancer." - Louise Gluck.

3) "I'm starved." -Juli
"How can you be starved? You just ate a huge bowl of popcorn [jalebis]." -Elspeth
"Popcorn[Jalebi] isn't food, it's popcorn[jalebi]." -Vicki" - A Quick Bite.

1) "Do you forget that I am your sister?"
"No; I've never been granted the opportunity to forget it." - Frederica.

2) "When I was ten all I knew was that I hated the weird words used to describe whatever it was that was wrong with my brother to this day I think it all happened because he was overtaken by evil spirits that got loose in that haunted house ride at the carnival that summer. It's easier for me to make sense of it that way than it is for me to face the other way reality. And yet, those evil spirits that were unleashed be they fake entities from a stupid carnival ride, or cruel malevolences from dark spiritual chasms of our universe have stayed with me all these years" - ORPHAN Stories.

3) "He's my brother, my blood. He annoys the hell out of me most of the time, but when it comes right down to it I want to see him graduate from college and have little annoying mini-Alexes and mini-Brittanys running around in the future" - Rules of Attraction.

1) "A daughter without her mother is a woman broken. It is a loss that turns to arthritis and settles deep into her bones. " - Summer Island.

2) "But mothers lie. It's in the job description." - John Green.

3) "You are evidence of your mother's strength, especially if you are a rebellious knucklehead and regardless she has always maintained her sanity." - Criss Jami.

1) "Turn your wounds into wisdom." - Oprah Winfrey.

2) "[You] should no longer define myself as the son of a father who couldn't or hasn't or wouldn't or wasn't." - Caged: Memoirs of a Cage-Fighting Poet.

3)"This is part of what a family is about, not just love. It's knowing that your family will be there watching out for you. Nothing else will give you that. Not money. Not fame. Not work." - Tuesdays with Morrie.

1) "I believe if I refuse to grow old,
I can stay young 'til I die." - Stephen Schwartz.

2) "If God had intended us to follow recipes, He wouldn't have given us grandmothers." - Linda Henly.

3) "As I learned from growing up, you don't mess with your grandmother" - Prince William.

1) "Sweet, crazy conversations full of half sentences, daydreams and misunderstandings more thrilling than understanding could ever be."- Beloved.

2) "May and I are sisters. We'll always fight, but we'll always make up as well. That's what sisters do: we argue, we point out each other's frailties, mistakes, and bad judgment, we flash the insecurities we've had since childhood, and then we come back together. Until the next time. " - Shanghai Girls.

3) "But what Mom never told me is that along the way, you find sisters, and they find you. Girls are cool that way." -Viola in Reel Life.

1) "Mothers can forgive anything! Tell me all, and be sure that I will never let you go, though the whole world should turn from you." - Jo's Boys.

2) "Mom had the kind of love for her that you could feel, like it was part of the atmosphere" - Down the Rabbit Hole.

3) "A good mother is irreplaceable." - Adriana Trigiani.

1) "This is so weird. They're your brother and aunt."
"No, I understand. They're your family too." Rhys said. "They loved you and raised you. That's what family is, right?" - Switched.

2) "When everything goes to hell, the people who stand by you without flinching -- they are your family. " - Jim Butcher.

3) "That's what people do who love you. They put their arms around you and love you when you're not so lovable." - Deb Caletti.

1) "Ethan [Arnav] was loyal and funny and protective. When we were little, he was the brother most likely to make me cry and mostly likely to wipe away my tears." - Prey.

2) "Even though Graham[NK] and I went back to arguing and stealing socks and hiding each other's toothbrushes in the litter box, I didn't forget that Graham didn't think I needed a best friend, because either it meant he thought I was cool enough to handle everything alone or and this was what I hoped it meant that he was my best friend, quietly, forever, no matter what.
I mean, after all, whose skates had I been wearing?" - Zombie Tag.

3) "Being his real brother I could feel I live in his shadows, but I never have and I do not now. I live in his glow." - Private Peaceful.

1) "What strange creatures brothers are!' - Jane Austen.

2) "Never hold resentments for the person who tells you what you need to hear; count them among your truest, most caring, and valuable friends." - Just Another War Story.

3) "Maybe one [brother] is enough" - Split.

1) "The bond that links your true family is not one of blood, but of respect and joy in each other's life. Rarely do members of one family grow up under the same roof." - Illusions: The Adventures of a Reluctant Messiah.

2) "I know all those words, but that sentence makes no sense to me." - Matt Groening.

3) "There is no such thing as a "broken family." Family is family, and is not determined by marriage certificates, divorce papers, and adoption documents. Families are made in the heart. The only time family becomes null is when those ties in the heart are cut. If you cut those ties, those people are not your family. If you make those ties, those people are your family. And if you hate those ties, those people will still be your family because whatever you hate will always be with you." - C. JoyBell C.

1) "I don't care about whose DNA has recombined with whose. When everything goes to hell, the people who stand by you without flinching--they are your family." - Proven Guilty.

2) "There is nothing that moves a loving father's soul quite like his child's cry." - Joni Eareckson Tada.

3) "The monsters are gone."
"Really?" Doubtful.
"I killed the monsters. That's what fathers do." - Fiona Wallace.

1) "When your mother asks, "Do you want a piece of advice?" it's a mere formality. It doesn't matter if you answer yes or no. You're going to get it anyway." - Erma Bombeck.

2) "Home is where you are loved the most and act the worst." - Marjorie Pay Hinckley.

3) "Becoming an aunt is completely out of one's control. When your sister or sister-in-law becomes a mom, you become an aunt. There is no life planning or great thought put into this occasion: basically, it just happens! And it changes your life." - Unknown.

1) "Friendship is born at that moment when one person says to another: "What! You too? I thought I was the only one." - C.S Lewis.

2) "Sometimes I guess it just feels better to know that you have someone to help you when you can't even help yourself. - Rebecca Gober.

3) "There is nothing better than a friend, unless it is a friend with chocolate[jalebi]." - Linda Grayson.

1) "It is more fun to talk with someone who doesn't use long, difficult words but rather short, easy words like "What about lunch?" - Winnie-The-Pooh.

2) "When tough times come, it is particularly important to offset them with much gentle softness. Be a pillow." - The Perpetual Calendar of Inspiration.

3) "Being a son, brother, uncle and brother-in-law is all I care about" - Chris Burke.

1) "One day you will do things for me that you hate. That is what it means to be family." - Everything is Illuminated.

2) "Sticking with your family is what makes it a family." - For One More Day.

3) "I believe that more unhappiness comes from this source than from any other--I mean from the attempt to prolong family connections unduly and to make people hang together artificially who would never naturally do so." -Samuel Butler

1) "A girl should be two things: classy and fabulous." - Coco Chanel.

2) "Your best friend is the person who not only knows all the important stories and events in your life, but has lived through them with you. Your best friend isn't the person you call when you are in jail; mostly likely, she is sitting in the cell beside you." - Best Friends Forever.

3) "Yesterday brought the beginning. Tomorrow brings the end, and somewhere in the middle, we became the best of friends." -Unknown.

1) "That was what a best friend did: hold up a mirror and show you your heart." - Firefly Lane.

2) "She's always there for me when I need her; She's my best friend; she's just my everything." - Ashley Olsen

3) "When a man's best friend is his dog, that dog has a problem." -Edward Abbey

Edited by ~Saraa~ - 01 June 2013 at 1:31pm

The following 186 member(s) liked the above post:


-chamkilli- IF-Stunnerz

Joined: 07 March 2012
Posts: 42058

Posted: 21 May 2013 at 5:22pm | IP Logged

A perfect love story, hatred and then love. Throw in some villains and it becomes epic! This was the case with IPKKND when there was Arnav-Khushi, there had to be a few villains too. Here's a dedication to the hard-work of these villains in making us hate them with a passion.

Shyam Manohar Jha

Married to Anjali Singh Raizada under some unexpected circumstances and apparently working as a successful lawyer, Shyam Manohar Jha has a feeble corner for Khushi in his heart, which turns into an mania. His obsession towards Khushi results in him plotting against Anjali and Arnav, but still managing to stay safe by efficiently playing the role of a doting husband.

Unconsciously or, to say, consciously planned by 'Devi Maiya' Shyam played the role of a cupid between Arnav and Khushi in each phase of their love story; if it would not have been him, Arnav and Khushi would have never met, firstly. He was the one who had found a job for Khushi, lest for her joining the main office was Devi Maiya's wish.

Lavanya's entry in the Raizada Mansion was all preplanned by Shyam, in the mission 'Woo Khushi!' which led into an unexpected swirl of events; I guess I don't need to elaborate what it led to!

Arnav-Khushi's first wedding! The pronunciation of these words sends butterflies eddying in our stomachs. Let me let the emotions sink down before continuing. Arnav on his way to propose Khushi for marriage, when, there was the great Shyam, apparently jealous of her close proximity to Arnav, and destroyed everything with his stupid talks with Khushi! Let's see the positive aspects of it, without Shyam Arnav and Khushi would not have had such a prompt marriage.

'I love you!' That was probably the best part of the show when Arnav confessed his love for Khushi, from the bottom of his heart, exactly like one would expect in fairy tales, except from the hero being kidnapped! Let me refresh the memories; if Shyam was not here, Arnav would have never been kidnapped, he would have never realized that without Khushi, he was like a sea without sand, like a temple without god, like a person without life; and he would have never admitted his love for Khushi!

Last but not the least, if Shyam would not have been here, we could have forgotten the drastic transformation of a noble, defiant Anjali, to a fervent, autonomous and self-assured woman, depicting the strong women of our days.

The antagonist, Shyam, was strategically planned; he was like an invisible giant whose slight tremor could cause a real damage to the Raizada clan. Despite, his aid in the progress, the development of the characters was much needed and we should just take a bow and thank him for being here! 
Keep calm and Dhaiya Ho!


Subhadra Devi a.k.a Dadi

How can we overlook her? Always clad in white colored saris, a bespectacled woman, she was the only character in 'Iss Pyaar Ko Kya Naam Doon?' who didn't need words to express herself. Her hand stiffened in the air always made her have the last word, or last action maybe.

Arnav's possessiveness towards Khushi, Arnav and Khushi's remarriage, Garima and Arnav's dad's disclosure even till the trepidation set over Manorama, had Subhadra as a main cause!

"Jahaan meri Patni ko andar jaanay ki ijaazat nahin, wahan meri koi zaroorat nahin hai"  Who doesn't remember this dialogue of Arnav who was seen becoming overprotective, day by day, over Khushi. He stood as a pylon by Khushi's side at all times of life, since Subhadra's entry in the show. This is definitely because of her, that Arnav became more possessive whenever Khushi was in the picture. Not to forget, the famous line known by all the fans, "I love you dammit!", expressed by Arnav in a state of anger, where Subhadra was witnessing the whole scene. This would have definitely not been expressed by Arnav if Subhadra wouldn't be there.

Besides acting as cupid, which was the main task of all the present villains, she also had a major hand in restoring all relationships; she was the only one who set trepidation over Manorama who was never scared of anyone, not even her mother-in-law! She succeeded in having an upper hand over her, taming her, making her become a more responsible mother-in-law as well as daughter-in-law. 
Helping in the clearing off of the mystery between Arnav's father and Garima, she once again succeeded in maintaining family relationships, even if it wasn't her true intentions.

Let me leave you all with the Arnav Khushi marriage which solely occurred after all the ruckus evoked by Subhadra Devi. We cannot end before thanking her for all her cooperation in the Raizada's lives.


Sheetal Kapoor

Arnav's college friend, and later turned enemy, she too acted as a villain in 'Iss Pyaar Ko Kya Naam Doon?' She tried a lot to set barriers in Arnav-Khushi's love marriage but utterly failed in her every attempt. She helped in proving that true lovers can never be separated; even if Arnav and Khushi's lives were filled with doubts at that time, they were always together, through thick and thin which was maybe the strong point of 'Iss Pyaar Ko Kya Naam Doon?'.
Sheetal left behind an adopted child who was then looked after by Arnav and Khushi, becoming their first child, Aarav.

All the villains in Iss Pyaar Ko Kya Naam Doon have greatly helped in the advancement of each bit of the show, the marriage of the leads, the development of all the characters; they on the whole unconsciously added beauty to the show, which was already exquisite!

Let's just let go a sigh and sit and contemplate the deeds of these villains, without which 'Iss Pyaar Ko Kya Naam Doon?' would have never been what it was!

Edited by ~Saraa~ - 01 June 2013 at 1:45am

The following 167 member(s) liked the above post:


somergasm. IF-Stunnerz

Joined: 13 April 2011
Posts: 27813

Posted: 22 May 2013 at 1:59am | IP Logged

Here are a few messages and gifts made by members from this forum. Hence the title that says "Love from around the globe." Big smile


Happy 2nd Anniversary Iss Pyaar Ko Kya Naam Doon! Party
Even though the serial is over, it is still alive through all fans :D
I have always kept IPKKND dear in my heart!
IPKKND has been a part of my life and has defiantly changed me for the better!
I am just so happy that I had the chance to come across it :')
Barun and Sanaya defiantly made the serial what it is :P
I will always be fans to them and follow them in whatever they do in life!!
The rest of the cast are very heartwarming and fantastic actors/actresses!
Thank you to the crew/creatives for working hard to make the serial what it was!
Lets keep IPKKND alive for many years fellow fans!
Iss Pyaar Ko Kya Naam Doon FOREVER!

Sharna xx


I have also made some creations for the anniversary thread!
Here they are:




"Iss Pyaar Ko Kya Naam Doon?"
The title itself is magical and so was the show.
6th June 2011 was the day where this show came into our lives. Since then Arhi has been rolling our hearts. IPKKND is a treasure, which I will always keep in my heart safely.



Happy 2nd Anniversary, my beloved show IPKKND! Though it has ended, the light moments of the show brighten up our souls, Arhi's love ignites our hearts with love and the smiles of the characters will remain plastered onto our faces, a sign that it will never be forgotten!
I Love  IPKKND, Arnav, Khushi, and the whole Raizada family and I know that I will keep on loving it until I die! 
 Love, Mariam


OMG I just cant believe that it has been 2 years since IPK started ,that day,June 6th ,was the start of the show which took the world by storm,which gave us Arnav and Khushi,two phenomenal characters. Each of them polar opposites and that tagline was what drew me in "Nafrat Paas Aane na de,Mohabbat Door jaane na de" Their meeting,the hatred in them,the day when Khushi came to know that she had to work for Arnav Singh Raizada,the Business Tycoon,the Warehouse scene,the temple scene,the Rabba Veys,the Payash Wedding filled with Arshi moments,the Haldi,the Kiss,the terrace scene(How many times they used to show it LOL)the forced marriage,the Misunderstanding,the love which was still there ,the moments spent in Khushi's place after marriage,the "Swami" scenes which had me in splits,then the ill fated kidnapping,where we missed Barun so much! 

The day he comes to know everything,the first I LOVE YOU,the day they are back together again,Arshi moments which we awaited eagerly ,for the clock to strike 8,their Marriage,throwing Creepwa(as he was "fondly" knownLOL) out,then Aryan coming into their life with the annoying Sheetal,Arshi exposing her real self,cute NK,Hello Hi Bye Bye,Lakshmi goatwa,Stopwa,Di,Payash,everything made up IPKKND ! <3 Waiting for the Offscreen segments,seeing SaRun's friendship,our days used to become complete <3

And today,even if the show is not on,it is there in our hearts still,Arshi will be evergreen always and SaRun remain BFF's for ever <3 Thank you so much Gul Khan for bringing such a show and Kudos to the entire team for giving us such a beautiful show to cherish <3 Here's to IPKKND,the Show which will remain in our hearts always,forever and after <3 Congo everyone on 2 years completion! Hug

Abhinaya (-sweetgal19-)



On this special day, best wishes go to  the whole Iss Pyar Ko kya naam doon team,  For the  wonderful love  u  guyz  share with us through the show...Embarrassed  May this love and memories last  through  the lifetime...EmbarrassedHappy anniversary to u my Love(iss Pyar Ko Kya naam

6th June 2011 (Monday) Indeed a Magical and historical day for all the Arshians and Ipkkndians.. I have never thought in my life that a simple Daily Soap will gonna change my life like this...I have watched many shows in my life till today,but the magic ,the love I have felt through Ipkknd is totally unforgettable...Smile

So its 6th june 2013 now...i cant still believe that its been 2 years already..Arnav and khushi's nat khat,their nok jhok ,their masti ,their love for each other, The raizada family ,the gupta family everyone of that show and everything related that show were indeed a treat to watch...The show compelled me to feel love,craziness,happiness everything by god...Embarrassed

Khushi ki nat khat pan,her craziness ,her jolliness , Nk's broken HindiLOL,Mamiji's Broken EnglishLOLBuaji's nand kissore,Arnav's Smirk &what the everything r now the sweetest memories of this show which i will gonna cherish in  my whole life...After all this is the 1st and i think lst show Which i have enjoyed and loved to the coreHeart...

happy 2nd anniversary to IPKKND team and to all the fans thought the world...I wouold like to bow down my head to this team who have worked so hard more than 12-15 hours only to entertain us...

Barun Sobti aka Arnav Singh raizada
Sanaya Irani aka Khushi Kumari Gupta Singh Raizada
Daljeet Bhanot aka Anjali Jha
Abhas Mehta aka Shyam Manohar Jha
Akshay Dogra aka Akash raizada
Deepali aka Payel Raizada
Uthkarsha Naik aka Mamiji
Saana khan aka Lavanya
Shashi Gupta
Hp,OP (Prakash Brothers|)LOL
Happpy singhLOL
And the lst not least  our invisible Aman...LOL

and of course to Gul and the whole PH 4 Lions...Smile

u guyz have made this show even more better and Barun &Sanaya's excellent performance and chemistry have made the show even far far better  in the bad tracks also...Smile...We not only enjoyed u watching onscreen but also ofscreen too... Love u guyz...We are missing u a lot..I wish we could get the show back again...Long Live IPKKND and the memories of course...Embarrassedi hope all the actors of this show can be more successful in their life and can just stay happy and blessed all the time...Smile

All the best To Ipkknd team ...U guyz r awesome...And yes this show is truly unforgettable...Smile


Happy 2nd anniversary to the show whom I breathed,lived for 1.5years day n night ,morning and night,everytime..

The show which gave me ARSHI.
The show which gave me my ARNAV SINGH RAIZADA..
The show which gave me Khushi...
The show which gave me SNAKEWA...
The show which gave me Hello hi byee byee..
The show which gave me Invisible PA Aman ,,
The show which gave me Rocky,lallan,Manu
The show which gave me Ranisahiba
The show which gave me Innumerous memories along pool side..
The show which gave me Rabba Veys
The show which gave me so amny good friends to cherishSmile

Miss u IPKKND..No other show can replace the void created by you.. I cnt go to such extent of madness for any showCry



Happy 2nd Anniversary IPKKNDIANS...PartyDancing

6th June 2011 is where it all startedDay Dreaming

Cant even tell you guys how nostalgic I am feeling today...Cry

Missing Asrhi soo much today..There are jodis that will come and go but no 1 can replace our ArshiCry

I miss arshi passion,masti,chemistry,hottness,cuteness and everything about them...Cry

Hats off to Barun Sobti and Sanaya Irani for making Arshi so real..ClapSmile

And Big Thank You to the makers for giving is Epic ARSHISmile

A Big big Thank You to IPK DT for baring usLOL we were not that well behaved membersLOL

I miss this active forum...Cry

We fought,laughted,danced,drooled,cried together..LOL

This forum and IPK gave me some wonderful friends aswell...JHAPPI to all my buddiesHug

Though IPK is not with us always remains in our heart..ARSHI was is and will be the most EPIC couple on Indian TelivisionCool

They say once an IPKKNDIAN is always And IPKKNDIANApprove

Happy Aniversary once again IClappkkndians...and many more are to comeParty


IPKKND is very special to me !!!
its the first ever show which became my addiction and obsession !!!!
i have some very good memories related to this show !!!!
Arnav and kushi will remain in my heart forever !!!!


It was sometime last January when I first caught the glimpse of the khadoos Arnav Singh Raizada smiling and something just clicked. I hadnt watched the show before it, I wasnt a fan of SaRun and I didnt know who were ArHi but that one episode (it was the cow-eats-pattal-as-ArHi-stare Rabba Ve :p) and I was hooked. I scrounged through YouTube, watched all the 'love' scenes, wondered where the hell was the love in more than half of them but then realized its their nafrat which is actually the love. Sigh.

Its been a year of IPKKND and I cant imagine why it hasnt been two and why it cant be three. A beautiful show, a stellar cast and fantastic bonding - the definition of 'Iss Pyaar Ko Kya Naam Doon?' The story was brilliant, the dialogues authentic, the speaking style original and the actors beyond amazing and if I may say so it got some of the best (and the worst ;) :D) fans too but whatever kind they may - the largest fan group it was.

IPKKND still stays in our hearts, some 6 months after it has gone off air, because of its lasting value which came from the brilliance of all involved in it - the writers, the actors, the directors and the dedicated fans. Its one show whose GIFs also make you emotional and nostalgic and thats the power of IPKKND. Twitter pe trend aise hi nahin karta kuch! ;) :D

London se lekar South Africa tak, Mauritius se lekar Dubai tak aur apne India aur Pakistan to hai hi, IPKKND ne dhoom machaa di and it shall always be remembered for its onscreen fantabulousness as well as its off-screen masti! 

On a personal note, it gave me Barun (bolne mein kya jaata hai? :p) and I shall be thankful cos he is one hell of a celeb to love! <3

And Sanaya who is fantastic and beautiful and graceful! <3

And Akshay who is hilarious and Karan who clicks photos in only one pose!

And the awesomest Nani, Maami, Buaji! <3

And it gave me back my writing like never before. I was writing on it barely a month into watching the show and for me thats huge because I cant write FFs till I am able to understand the depth of the characters and the fact that IPK was able to give me that in such a short time shows the brilliance of its conception. I am still writing and every song, every film, every scene, every moment makes me imagine ArHi on them and thats something!

So thank you IPKKND for the amazingness and the inspiration and the IPKKND forum and the friends I made there! <3

And for Barun of course! ;) :D <3 <3

Here's hoping, however irrationally, that you come back one day with the same cast and the same crew and create a little more magic! <3


Here are my wishes & Signatures for the second Anniversary -

If you find any problems in opening them please let me know!



I remember 2 years ago , I waited so excitedly for a show which had caught my attentions from all its promos... Then time came..and I never look back from then.. Its been amazing ride with IPKKND ,I have never loved a show as much as this one..What was so special..perhaps it had that divine connect with audience as well.. We connected to Story of Arnav-Khushi..Some seeked their partners in them...Some seeked themselves..But it was all about Love..A Love being displayed as never before .. I am thankful to all the people who are involved in bringing this show in front of me... CVs, music people, Cameramen, directors, dialogue writers, all technicians involved -Thank You !
Barun Sobti ,Thank you so much for bringing Arnav Singh Raizada alive in my life.. I have never loved any reel character this much... Your brilliant portrayal of ASR made me fall in love head over heels with rude and Arrogant ASR..
Sanaya Irani- Thank you so much for bringing Khushi into  Arnav Singh Raizada's life and making this love story complete..Khushi always made me laugh, made me cry at times...even made me angry at times too...
Daljeet Bhanot- Thank you so much for giving us Anjali Di...our loving Di
Abhaas Mehta- Kudos to you coz I have really hated you onscreen and also thanks to Karan,Deepali, Pyumori, Akshay ,Uttarksha and Jayshree jee... I loved everything about this show...
A Big thank you!
I wish everyone associated with IPK gets all success in their lives...God Bless You All..
Arnav-Khushi will always be cherished as wonderful memory for a long time...


6th June is here!

My IPK was born today! It has turned into 2 now! Happy birthday IPK!!! :D :D


Um'I wanted to say, no no'I just'um'dart! Where is my speech paper? *checks pocket*

Sheesh! Forgot on study table! :/

Um'hello Hi bye'sorry! Hello everyone! I'just'Dart!


Um'people I forgot that paper of speech on table but my heart is still with me and I believe that when something is close to your heart you don't need any paper to speak it.

Though, I rehearsed my speech like million times, but'lets forget it! :P

I tell you something'no no, not any sad story'but my theory about television in my childhood. Don't laugh, okay!

Let's begin!


I remember, when I was a kid I used to think, there is secret cameras installed in each and every house and whatever we watch on TV is things happening in real.

Going by this theory, I was once watching a Bollywood award function, and just a day before I saw a movie where one of the actress died. Though, I didn't understood anything about that movie, but I remembered that, that actress died. So, what happen, in that award function there was a dance performance by that actress and I exclaimed to my mom," Aree Ma! Kal toh yeh marr gyi thi naa" (Last night, she died naa)

My mom laughed and as far as I remember she just said," No my baby! She is alive! And that was just an act"


I just listened to that and didn't question her further, probably coz I was least interested to know if that person is living or dead. Everyday, whatever mom watched I thought it was actually happening and in fact, I used to think, cartoons are also living! :P :D


Finally after years of forgotten research, I understood about all these and finally started considering everything as "Just an act"

I was weird kid! Yeah, I am not joking! I was "actually" wired one! I won't deny that I was the one who used to cry even just at a one word spoken in high pitch! Studious (then and now also). I used to feel weird when people around me used to talk about their favourite star'of course, cz I was never a fan of ANY star or show.

Then came a turning point of my life, leaving me wounded and alone! But, I don't hate my life for giving me moments like that, cz it made me understand who were mine and who were not.

Ops! Sorry got a bit drifted away!


So where I was?

Yeah! So, after some yrs of loneliness and depression, something came up which made me what I am today! Oh no no'I am not a big star or a super kid! I am Gazal now! It's finally me! I can never express what this show gave me!

It gave me reason to smile.

It gave me thousands of friends.

It gave me this forum.

It gave me confidence to keep my point of view.

It gave losses to my tissue company, who was no more needed cz I stopped taking anything at heart.

It gave me memories'to cherish, to relive and if possible bring it back!


After IPK ended, I thought I will move on. It's just a show!

That day, I didn't know what "Just a show" could do!

I stopped watching television! Believe me, my mom was the happiest and dad was one of the shocked being that day! I seriously missed IPK like hell! As soon as clock stroke 8, it was like'so empty'no Rabba vey nothing! Just a blank idiot box staring me with poker'actually no face! Not only rabba vey, I missed my excitements, I missed that running to forum just after show finishes, I missed that moments when I used to watch television so that I could be the first one to post about promo, if there's any! I missed, how I used to do anything to watch repeat'I missed how I used to forget everything as soon as the show started.


IPK was magical! It not only took me away from this world, but made me understand that rather than looking at the things that makes me unhappy, I should look at the small things that could give me pleasure which is equal to heaven.

Example, Khushi's happiness due to mere jalebi. I used to think, how could anyone be happy with just a Jalebi'but slowly I understood, what wonders jalebi could do!


IPK gave me many special things and out of all is this forum! All kind of humans; serious, jovial, sarcastic, stalker, ultimate humorous, silent, poky, guttery are available! ;D And, common between all was, we all were proud victims of IPK! Everyday here was a festival. Even if ArShi had megre eye lock, whole forum was coloured with colours of happiness and love. Each post had new discoveries in the episode.

If someone reads each post, one will find, how episode were examined'observed'and every second a post would spring up saying "Eureka!"

Imagine if we all had done so much research in our studies, we would have been successful scientist by now! ;) :P

And if spoilers would come out then *Phew*'MODs on duty! One spoiler and hundred posts were made speculating what does spoiler mean or what are your views on it. OS were written, party was made on good news and there was not a single minute I or I believe anyone would have logged out that day! But, I sincerely salute our MODs for managing us, the jungli's IPKians (LOL)

Show ended and I don't want to mention anything about it or anyone!


Yeah! I have moved on'or I say, I tried to move on! Today also, not even a single day pass when I am not watching ArShi scenes or VMs. Everday, I watch same thing, replaying it again n again and I never get bored'In fact, every moment I feel proud to be fan of such a great show! I feel proud that I was fan for the first and last time of such a great show, great actors, and fantastic cast!

Life is incomplete with IPK! I still miss them! I still miss that magic and try to find out in other show. But, the level that IPK had set is something which other show would never be able to reach! Words can never describe what IPK means to us'to me'to its cast!

*Sniff* *Sniff*

I think I should stop here. Becoz if I say more, I know, I might end up making you all cry and again MODs had to be on duty to delete several crying posts and would Ban and curse me for this! Kidding! Jokes apart, I would end up my gheesa pita speech and end with Arnavji's line, modified in my way! ;)


Yaha naa sahi, par shayad kahi aur ek duniya hai,

Where Laxmiji is still missing from RM,

Where Maami is still 25 yr old,

Where Anjali is still PoojaThali,

Where Shyam is in jail, twitching his nose like ever,

Where little Aarav still plays basketball,

Where NK still speaks his brilliant Hindi,

Where Buaji still chants about her Nandkishore'


And where, a very beautiful world of Arnav and Khushi exist,

Still by the pool side they sit and watch their parents,

A beautiful world which left us in awe!

I know today every one want to agree on my childhood theory about their existence in reality! Today most of you want to close your eyes and get drowned in that beautiful world of IPK!

Signing off with a hope that I would see this magic again! Once again, happy birthday IPK and IPKians, afterall, you all were born Bcoz IPK was born! ;)

Love you all,



Hamare Arnav aur Khushi
Ghar ke chotey pardey par, bani ek prem kahani
Is kahani ki huyi saari duniya diwaani
In donon ki chavi, sab ke man mein basi
Aise thay hamare Arnav aur Khushi
Na takraar ki kami thi, na kam thay jazbaat
Chingaariyon se bhari thi, inki har mulaqaat
Kabhi nafrat ki thi chingaari, kabhi thi nashili
Aise thay hamare Arnav aur Khushi
Sapne huye poore, woh bani unki dulhan
Kayee mushkilon ke baad hua inka milan
Saazishein bahut huyi, inka pyaar chadha na bali
Aise thay hamare Arnav aur Khushi
Mahiney beet gaye, par inhe koyi na bhoola
Bas yehi baat, har ek ka dil bola
Na pehle thi aisi jodi, na phir hogi kabhi
Aise hain hamare Arnav aur Khushi
On the small screen at home, there was a love story
The whole world became crazy for this story
Both of their reflections was in everyone's heart
This is how they were, our Arnav and Khushi
There was no dearth of conflict, nor of emotions
Their every meeting was full of sparks
The sparks were sometimes of hate and sometimes intoxicated
This is how they were, our Arnav and Khushi
The dreams were fulfilled, she became his bride
After many difficulties their unity took place
There were many conspiracies, but their love was not sacrificed
This is how they were, our Arnav and Khushi
It has been months, but no one forgot them
Only one thing, every heart said
There was never such a couple, nor will be there again
This is how they are, our Arnav and Khushi


love the show and keep on remembering and watching it again and again



A very Happy 2nd Anniversary Iss Pyaar ko kya naam doon?
This show was not only unique but also's definitely one of the best show in television. This wasn't just a show for me it was a part of my life.i had a very beautiful journey wid ipk n i really miss that days.. Cry
We got our favourite couple Arshi wid ipk n what can i say about this wonderful couple Day Dreaming IPK will be unforgettable show for me due to arshi's intense lovestory n the sizzling chemistry.. Embarrassed Embarrassed we laughed,loved,cried wid them..
Arshi the most perfect couple forever.. No one can perfect like u.. Heart
Thanx Barun n Sanaya for brilliant performance as Arnav n khushi.. Smile Smile
This show is my all time favourite show. it had creat a special place in my heart no any other show will ever take that place..IPK was d best n will remain best.. Smile
Happy birthday my dearest Iss Pyaar ko kya naam doon.. Heart


These are free to use signatures:


To my beloved IPKKND i love you so much and i miss this show so much. I miss Barun and Sanaya and i cant find another jodi to match up to you guys and i wish to see you guys on screen together again.
I still live with the memories of this show and i watch an episode everyday like if the show was still on air- thanks to the Blasters of IPKKND forum in IF.
I wish the show was still on air to celebrate this 2nd Anniversary but i do hope to hear from both Sanaya and Barun on the anniversary celebration.
Miss you guys and the show and all the best on your future endeavors.
Love totally from Oma Ramdass.


:Teri Meri:

 :Rain Hug:


Congratulations to every viewer and cast of IPKKND!!
Ipkknd is my fav show not just because of ArShi/SaRun but because of the whole cast...every member of the cast were OUTSTANDINGClap
Thanks Gul for giving us IPKKND and ArShiSmile
IPKKND was unique not only for its on-screen story but also for off-screen masti of the castSmile

Happy 2nd Anniversary IPKKNDians...


Iss Pyaar Ko Kya Naam Doon has/will always been very close to my heart. It will be etched in my memories forever. Initially when I started to watch this show I never knew I will love it so much!. Still I am really happy for the show. I am really proud to be ArHi's fan! I have laughed with ArHi, cried with ArHi. And this beautiful forum has also given me many friends. I have also learnt a lot from IPKKND. Thanks 4lionfilms for giving us a show like Iss Pyaar.

Blasters of the 'Blast from the Past' thread.

A post from the Blasters of the Blast from the Past thread

We are a group of people from the 'Blast from the past' thread and call ourselves 'Blasters'. We've have been watching IPK episodes regularly since 3rd December and have been reviewing, analysing and discussing the episodes on a daily basis. We are at present on our 12th thread. As we were watching the engagement episodes, through our discussions and analysis we've made some discoveries. Some of these had already been done when these episodes were being shown for the first time. Nevertheless, we would like to point out our discoveries as given below.
Engagement Discoveries
(Whose engagement was it?)



As we all know, Arnav tied the bandage on Khushi's left hand ring finger(LHRF). The finger, whose nerve is said to go straight to the heart. This was done in Devi Maiyya's temple at an auspicious time amidst chanting of the holy mantras. Instead of a ring, it was a bandage that was tied. The bandage is made up of cotton fibres. Cotton fibres are used to make holy threads to be tied on arms and wrists, Rakhis and also turmeric threads for Mangalsutra (in South India). So, we can easily conclude that engagement has taken place in the most traditional manner.

The ring purchase 

Shyam bought a ring using Anjali's money. Anjali's money is really a part of Arnav's hard earned money. So, the owner of the ring is actually Arnav.

Shyam - Khushi engagement  

Shyam never put the ring on Khushi's LHRF. He put it on one of the right hand. And anyway, Khushi's engagement has already taken place in the temple. And Shyam too was a married man. So, the Shyam - Khushi engagement is invalid.

Lost ring 

Khushi lost that ring and she never realised it till Buaji pointed out the next morning. Instead, she was lost in thoughts while looking at her wound on her LHRF, thinking about the bandagement. Something, a newly engaged girl would obviously do. Wink 


Arnav found the ring under his feet. In a way, he purified it with his feet. Later, the ring fell into a glass of milk. Milk is used for purification in various Pooja procedures. Also, ornaments are purified in milk before adorning the deity. Thus, the ring has been purified from all touches of any evil hands.
The ring crossed the hands of Nani, Anjali and even Lakshmiji. As if the ring has recieved the blessings of the ladies in Arnav's house. The milk has been understood to be a representation of Arnav's mother, as he would always take sips of milk to soothe his pain, be it after getting drenched in the rain (after rain hug) or eating hot spicy dal. So, when the ring fell into the milk, we can assume Arnav's mother too gave her blessings for the engagement. Also perhaps, when Arnav and Khushi were having the star talk near the pool side, their parents were blessing them. Because, only after that Arnav found the ring under his feet, as if their parents wanted him to do it.
The Final ritual
After a little tiff, Arnav returned the ring to Khushi. When Khushi was unable to put it on, Arnav took over and put the ring half way on Khushi's LHRF, i.e. till the proximal joint of the finger. The bandage that Arnav tied in the temple was till the proximal joint. So we could say, that he had put a ring in her finger all through - the proximal one third with a bandage and the distal one third with the ring. Embarrassed  
Then, Anjali came in and put the ring completely on Khushi's LHRF. In many places, it is the mother or sister of the groom who puts the ring on the bride's finger. Thus, the engagement of Arnav and Khushi has been completed. Dancing 
So, we can conclude that it was Arnav and Khushi who had been engaged and Shyam was never engaged to Khushi. Shyam is Arnav's sister's husband. Arnav considers his sister as a mother. So, that would put Shyam in father's place. So, can we assume that Shyam was giving a gift to his would be daughter-in-law when he gave the ring to Khushi? LOL 
Here's a small poem to celebrate the engagement of Arnav and Khushi
Badhai ho badhai,
Arnav Khushi ki huyi thi sagaai
Is rasam ko poora karne wali thi
Shyam babu ki lugaai
(Congratulations, Arnav Khushi had got engaged, the ritual was completed by Shyam's wife)
The picture edit is by supriya.arshi. The gifs are by Katelyn.
Blasters who have contributed to the discoveries and also those who have supported the theories are: BarunDiwani, ArshiHamesha, wiwy, indi52, DurgaS, chalhov, Horizon, samin6, Katelyn, cinthiann1758, sohara, Anita, supriya.arshi, shesherkobita, Arshidiehardfan, goofy, RebeccaDaphne, salooni, ina211 and all our silent readers.


Iss Pyaar Ko Kya Naam DoonHeart
EmbarrassedIss serial ke liye mere pyaar ko kya naam doonEmbarrassed
Its an epic love story Heart8 to 8:30 was the most precious & my most fav time Day DreamingLove this show to the peaks HeartThe only reason is ASR BlushingThis iconic character changed my life SmileASR ne mujhe pyaar karna sikhaya HugI want a husband like Arnavji EmbarrassedOn this occasion I wanna thank BARUN SOBTI for being ASR & for giving me my first ever love ASR HugAfter ASR I started loving BARUN SOBTI to the core of my heart HugLOVE U FOR EVER BARUN SOBTI, ASR, IPKKNDHeartHeartHeart


A small wish from a great fan ! Heart

I can't believe it has been 2 years since the magic has started !!
These two years were one of the most beautiful periods of my life !!
I can't express all my feelings in a single post. And it is impossible too !
I just wanna say that IPKKND changed me !!   IPKKND changed my life ! Heart

I wish that all the wonderful people who took part in this legacy  
should go great heights in their lives and achieve what they wanted !!
I wish them a great future from the bottom of my heart !! Heart

IPKKND forum is the most awesome forum i've ever seen !!
Keep rocking n keep posting buddies !!
I hope i'll be there to comment on IPKKND's 50th anniversary !
Praise lord !!!Heart

With Love,
A Proud Arshian Heart


- Heba Nazim


The most romantic and beautiful love story ever.
My first ever Indian telly serial, that i follow like religiously..
It is where i get to know the most talented and beautiful couple...Arshi..
and the whole gang of awesome characters...who are just unforgettable...

Thru IPK,  i witness the very great bonding of fellow actors on the set and out...
i learn what it is like to act among friends...
the bonding, the laughter... it is really like a family..

Thank u 4lions, for making this awesome awesome show.
Thank u to the rocking stars...
Barun, Sanaya, Daljeet, Abhaas, Karan, Akshay, Deepali,
buaji, mamiji, mamaji, naniji..

IPK lives on in our hearts..
Here's wishing for many more anniversaries...



2 years ago, on this day Iss Pyaar Ko Kya Naam Doon came into our lives. A love story of two star crossed lovers with opposing personalities, torn between love and hate may have sounded simple and commonplace.  But beauty lies in the simplest of things and the rarest of finds are found within the ordinary. That is what made it extraordinary. Two names, Arnav and Khushi, touched our lives and became so real, we lived and breathed with them. Two actors, Barun and Sanaya became the faces of Arnav and Khushi and breathed life into them.

We felt their love, we felt their pain, and we laughed when they laughed, we cried we they cried and we rejoiced when they found love and happiness in each other.

Now it no longer graces our screens but once something touches your soul it leaves its mark forever. We miss it every day and crave its presence, and we try to find solace. It may be gone, but the memories are cherished. It gave us happiness and that thought brings a smile to our faces. Even though it is gone, it will never fade. It will shine like the brightest star.

Today we observe this day, to celebrate everything it means to us. We found happiness and love; we bonded with others who felt the same love. We made friends and became a part of the IPKKND family. Today we shouldn't cry because it's over, we should smile because it happened and thank everyone who made it possible.

Happy 2nd Anniversary Iss Pyaar Ko Kya Naam Doon. You have made a place in my heart and you will always reside in it.



Happy 2nd anniversary to all IPKKNDians and the team of IPKKND Party Two years back the best TV show of the whole wide world graced our television set to create history, and a special place in our heart Approve Indeed, IPKKND has been thoroughly anchored into our hearts and all the memories attached to it cannot be erased Embarrassed

6th June has become a special date for me, it is the day where unknowingly I was embarking upon a new journey, a journey of mixed emotions, namely love, passion, excitement but also anxiety, sadness, anger Clap IPKKND is the only show that has been able to get me gripped at all times, made me laugh and also made me cry Star

Who would have thought that a show could generate such an impact on me? Ermm I just feel that IPKKND has become a part of my daily routine, yup it still is even after it has been abruptly ended Disapprove Because there is no single day I can stop thinking about Arnav and Khushi, what their lives would have been now. I miss them so much Broken Heart And it's a must to watch their most loving scenes daily Big smile Thanks to IPKKND, I have met such wonderful people on this forum which has given me the best friends anyone could wish for Embarrassed

The real catalyst of my love for the show is undoubtedly Arnav and Khushi, which is synonymous to Barun and Sanaya because I just cannot imagine Arhi without Sarun Day Dreaming They spread so much magic on the screen that I sometimes fail to realise that it is just a show, not reality LOL Arnav and Khushi make a mesmerising couple which is the best portrayed any time Hug

Barun, thank you so much for being Arnav Blushing You have infused life into a character which we were supposed to hate at the beginning but which we could only love Heart You are an extremely talented actor and an even better individual Big smile And Sanaya, it is remarkable the way you portrayed the bubbly role of Khushi but at the same time, delivered emotional scenes convincingly Clap Finally, I would also like to thank Daljeet, Abhaas, Akshay, Deepali, Karan, and the remaining cast for making such a great ensemble cast Big smile I think it is the best cast that I have ever seen...such great rapports with each other and a friendship that can been transposed onto screen Star Of course, without the production team, the creatives team, the crew and Star Plus, IPKKND would not have existed. Thank you again for bringing joy into the lives of millions of people HugHug

Loads of love from a Forever IPKKNDian/ArHian Hug
Tashu <3


2 years gone by..But still everything's so fresh in my mind !
Starting from the first dialogue of the show-' Haire nandkishore' of our beloved Buaji , to Khushi falling in ASR's arm to 'Arnav-Khushi hamesha saath rahenge'..every bit is like yesterday only!
No matter how many years go by, no matter how many monsoon arrives..Memories of Iss Pyaar Ko Kya Naam Doon will never get washed away from my mind, from my soul !
Only the "..Mohabbat door jaane na de" part is what will keep IPKKND n the memories this epic show gave, alive in my heart always..HAMESHA! Heart

SIGGY created by me! Embarrassed


Wishing everyone on IPKKND 2nd Anniversary! PartyHug...
IPK and Arhi/Sarun  Remain Forever in my mind...Love them Lot!!!!
Miss them Lot!!!!!!!!!!!!!!
I wish the Sarun will  comeback  soon ..they are  the Most ~ evergreen romantic couple~
This serial is my all time favourite serial. It has create a special palce in my heartHeart. No any other serial will ever take that place in my heart. I really miss my all time onscreen favourite jodi  ARHI   Star & offscreen favourite jodi SARUNStar
Wish u all Happy Wishing everyone on IPK  2nd Anniversary! PartyHug

The rest of the messages will be in this thread only. So, please watch out for the ArHi-ness to unload.  Wink

Edited by -iLoveSobti- - 05 June 2013 at 12:46pm

The following 186 member(s) liked the above post:


Go to top

Related Topics

  Topics Author Replies Views Last Post
Iss Epicness Ko Kya Naam Doon?

2 3 4 5 6 7

Author: PixieFairy   Replies: 51   Views: 4412

PixieFairy 51 4412 01 August 2013 at 12:47pm by BerryBlush07
~IssPyaarKoKyaNaamDoon~ TITLE SONG

Author: NIDHI1414   Replies: 3   Views: 1879

NIDHI1414 3 1879 06 June 2013 at 12:35am by kunuarshi
Thank You SaRun For The Epicness Called ArHi

Author: manjha   Replies: 0   Views: 651

manjha 0 651 26 November 2012 at 9:56pm by manjha
Mamiji stands by Khushi in IssPyaarKoKyaNaamDoon

2 3 4

Author: maaneet_forever   Replies: 31   Views: 5098

maaneet_forever 31 5098 26 May 2012 at 8:54pm by OLGNES
Arnav 26 years and Khushi 20 years!!??


Author: sun2011   Replies: 14   Views: 4867

sun2011 14 4867 19 November 2011 at 4:17pm by sun2011

Forum Quick Jump

Forum Category / Channels

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index