Pyar Ka Dard Hai Meetha Meetha Pyara Pyara
Pyar Ka Dard Hai Meetha Meetha Pyara Pyara
Pyar Ka Dard Hai Meetha Meetha Pyara Pyara



3/8/13 UPDATE NEW Offscreen pix Behind the scenes

PayaDesire95 IF-Dazzler

Joined: 22 January 2013
Posts: 3947

Posted: 08 March 2013 at 2:56pm | IP Logged

Disha at a wedding party in Mumbai


Disha Parmar BTS

Disha, Alefia, Nakuul and Sonali 

Nakuul, Kajal, Dadi, Alefia. Smile

Adi/Harish with crew on set. (Nakuul, Nitesh)

Pankhuri (Disha Parmar)

Nakuul with his award for Best Male Debut Award! Smile

Nakuul & Janke before awardsEmbarrassed

Mansi and Alefia bts Tongue

Nakuul & Disha 

Whole family together Embarrassed

Nakuul with his friends Ruslaan and Alekh on sets of PKDH Alekh plays Kapil

Disha on sets

Whole PKDH cast/crew on 1st anniversary celebration party

Disha at Gold Awards red carper

Sameer after wedding in PKDH

Nakuul Jankee and Rahul Mahajan 

Disha at her home in Mumbai

Nakuul as a kid

Sameer sitting by the pool 

Ashlesha Savant BTS posing after Rubal/Latika party on set 

Jankee, Ashlesha and Nitesh Pandey at a birthday party

Disha and Nakuul practice for dance in PKDH

Nakuul and Disha practice for proposal scene dance in PKDH

Disha on her phone after shooting 

Disha BTS after proposal scene in PKDH

Disha with a fan 

Disha and Nakuul before shooting for a scene in PKDH

Another of Disha Nakuul rehearsing for a scene in PKDH

Disha and Nakuul shooting for the wedding scene in PKDH

Disha with fans after shooting in PKDH

Disha Nakuul and Ashlesha BTS in Sonalis dressing room during lunch on PKDH sets

Manasi Salvi with someone 

Sonali BTS on sets of PKDH

Disha, Sonali and Prinal BTS after shooting in PKDH

Sonali Disha and Ashlesha after shooting for Nana Jii's death sequence BTS

Disha in a red saree BTS of sets of PKDH

Edited by PayaDesire95 - 03 August 2013 at 12:32pm

The following 69 member(s) liked the above post:

chhedavgkantuJANNAVsaman_khan24shifali339indiaforums85kie91jaasz_25Deepika_rosidchloe-ipkkndanushka30miss_patel5sunny_Gsp87ahutaelgeeDanikasinipillaiChit15Tamy95screen22XlovesuPrasRasReenBeanCamrynesameersaagar...SankaDevi...aarushhipournami-beena-scorpiodreamsSnowGirl18Savitha0101QueenAnnie18swaramSpotdipi.15meriyaaranju011A HUGE FANkrutiv100moon.river-Wishes-orpidlip-sakshi-shivamalasweetysaranmanan09sudi_4m_kolvioletshinemomo121preethi18S.H.I.E.L.D.chitloneranusha.cochin-suga-xMidnightStarxNihira-fanRoark-IAmShaz-xaviaraTOTAL-ROMANTICmaanluvsgeetMrDarcyfanSurish...Jes...X.shmmBadtameez_Dil

violetshine IF-Dazzler

Joined: 19 June 2012
Posts: 2650

Posted: 08 March 2013 at 3:18pm | IP Logged
Aww, thanks for sharing these pics they are lovely Smile

The following 1 member(s) liked the above post:


Danika Senior Member

Joined: 04 January 2009
Posts: 797

Posted: 08 March 2013 at 3:43pm | IP Logged
Such lovely pics.
Thank you so much for sharing Big smile

The following 2 member(s) liked the above post:


PayaDesire95 IF-Dazzler

Joined: 22 January 2013
Posts: 3947

Posted: 08 March 2013 at 4:03pm | IP Logged
Originally posted by violetshine

Aww, thanks for sharing these pics they are lovely Smile

You're welcome Smile

The following 1 member(s) liked the above post:


PayaDesire95 IF-Dazzler

Joined: 22 January 2013
Posts: 3947

Posted: 08 March 2013 at 4:04pm | IP Logged
Originally posted by Danika

Such lovely pics.
Thank you so much for sharing Big smile

You're welcome! Smile
anusha.cochin IF-Rockerz

Joined: 31 October 2011
Posts: 8873

Posted: 08 March 2013 at 8:44pm | IP Logged
Thanks alotBig smile

The following 1 member(s) liked the above post:


xMidnightStarx IF-Rockerz

Joined: 26 February 2012
Posts: 9785

Posted: 09 March 2013 at 12:22am | IP Logged
Aww, everyone looks fantastic :D

The following 2 member(s) liked the above post:


-Arnisha- IF-Stunnerz

Joined: 02 April 2010
Posts: 37094

Posted: 09 March 2013 at 12:35am | IP Logged
thanx they look great...

The following 1 member(s) liked the above post:


Go to top

Related Topics

  Topics Author Replies Views Last Post
Holi offscreen pics


Author: X.shmm   Replies: 13   Views: 3640

X.shmm 13 3640 26 March 2013 at 1:44pm by X.shmm
Cute Disha- Offscreen pics

2 3

Author: anusha.cochin   Replies: 16   Views: 4240

anusha.cochin 16 4240 18 March 2013 at 9:41am by ankur281
Disha Offscreen Pics :-)

2 3 4

Author: anusha.cochin   Replies: 26   Views: 4348

anusha.cochin 26 4348 13 March 2013 at 7:38pm by shivamala
Offscreen Pics

2 3

Author: anusha.cochin   Replies: 20   Views: 2738

anusha.cochin 20 2738 02 March 2013 at 11:11pm by tragedy
HarTika fans (Manasi+Nitesh) Offscreen picture

Author: PayaDesire95   Replies: 8   Views: 2721

PayaDesire95 8 2721 27 February 2013 at 12:30am by -sakshi-

Forum Quick Jump

Forum Category / Channels

  • Please login to check your Last 10 Topics posted

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index