Navya

   

RS: Love Happens <3 *Completed* Index page 1

Post Reply New Post

Page 1 of 148

Page 1
Page   of 148
Page 2 Page 148

titleepari

IF-Dazzler

titleepari

Joined: 30 January 2012

Posts: 3571

Posted: 18 August 2012 at 9:24am | IP Logged
Heya peeps.. I am back with another RS of mine.. Since we all know Shaheer is doing a Honeymoon sequence for his upcoming show Teri Meri Love Stories.. I have chosen Honeymoon as the back drop of my story.. But there is a twist in the tale.. Navya and Anant have had an arranged marriage in the RS.. This is the first part of the RS.. the honeymoon will start from the next update.. 

 

RS: LOVE HAPPENS <3 Chapter 1: That Night In The Room

 

 

Little did Navya understand what to do as she entered the room--her new room. She was scared, bit apprehensive as to what will happen.. she entered the room still scared,the lights in the room were on.. She looked around and found that the room was huge.. the bed was decorated with flowers and it looked beautiful but that only increased her anxiety and fear.. She saw the photo of the original room holder placed by the bedside and the reality struck her hard she was in a stranger's room. A person whom she barely knew.. And the funny part was this that it was her room too from now on. She went up to the bedside picked up the photo and said to herself "Anant Bajpayee. This is all I know about you. Is this much knowledge enough to call myself Mrs. Anant Bajpayee..." sighed Navya.

 "I dont even know if you are ready to share your name as a matter of fact even this room---your room with me." 

 

As Navya spoke to herself there was a knock at the door. She became conscious, placed the photo back and moved away from the bedside. She asked the person at the door to come in. 

 

The person was Anant.

 

Anant and Navya had had an arranged marriage that too a hurried one. Anant's grand father was ill and he wished to see him married. So Anant had to give his consent to marry Navya without even knowing her properly. BUT that does not mean that they did not meet before their marriage, they definitely did. But that was in the presence of all the family members. 

 

Anant wanted to meet Navya alone and had arranged for a meeting in a restaurant but Navya's family being conservative had sent Dadi along with her and hence Anant's wish remained unfulfilled.. It was Daadi who spoke to Anant all the time and the only thing that Anant ended up asking her was her hobbies which again was answered by her Daadi.. But from his meeting with Navya which he had mentally named "Mu dikhayi" he had deciphered one thing that the pretty girl he was about to marry was sigh and reserved.

 

Anant was awkward too and did not know what to say. They both stood in silence for sometime..

"Aaap...tum khari kyun ho?? Baitho na.." Anant spoke in an attempt to break the silence.

 

"baithu lekin woh.. main.. kahan.." said Navya, fumbling..

 

"Kahan?? bed pe baitho.." Anant gave an obvious reply.

 

The mention of the bed made the already nervous Navya all the more nervous.. She got scared and her fear showed on her face. Anant seeing her expression realized that she had misunderstood  and immediately said," woh tum bed ke paas khari ho to bed pe hi baith jao..bed pe nahi to tum sofe pe bhi baith sakti ho.. " said Anant pointing to the sofa.

 

"Nahi woh.. main thik hun.." said Navya.

 

Anant was about to say something to Navya when someone knocked at the door. Anant went up to the door to open it and found that it was Nimisha, his sister.

 

" Nimisha tujhe kuch kaam hai kya??" asked Anant

 

"Wah bhai kya main bina kaam ke aapke ke kamre me nahi aa sakti. shadi hote hi aap to badal gaye. par isme aapki koi galti nahi hai.. I can understand." said Nimisha teasing her brother. Anant could sense that Nimisha's teasing made Navya all the more scared and nervous and that the situation became increasingly uncomfortable.

 

"bakwas band kar Nimisha. Jaldi bata kya batane aayi hai.."

 

"arre baapre mujhe bhagane ke liye itne utwale ho rahe ho bhaiyya."

 

"Nimmi agar tujhe kuch kaam nahi hai na to ja ihan se."

 

"Acha baba ja rahi hun. yeh lo." said Nimmi handing an envelope to Anant."aapke honeymoon tickets aap niche hall me bhool aaye the."

 

Navya who had no idea about the tickets was shocked to hear the news and looked from Anant to Nimisha.

 

"Kya bhaiyya aapne bhabi ko nahi bataya honeymoon tickets ke baare me." asked nimisha " Bhabi yehi to hai papa ka gift aap dono ko. Honeymoon package" said Nimisha looking at Navya.

 

Anant said,"Haan woh main bhool gaya.. ab tera ho gaya to tu ja ihanse.."

 

"han baba ja rahi hun Bhabi ko Good night to bol dun... Good Night bhabi.. jaldi so jana zyada der mat jagna.. woh kal aapki early morning flight hai na.." said Nimisha in a teasing manner.. this only made Navya more tense..

 

As Nimisha left the room. He looked back at Navya who looked at him with a blank expression. Anant did not know what to tell her. There was silence again.


He knew the already difficult night has now become all the more difficult for them.


Likes Dislikes comments tamatar andes all are welcomeBig smile


INDEX

CHAPTER 1 PAGE 1.

CHAPTER 2 PAGE 5 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=5

CHAPTER 3 PAGE 13 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=13

CHAPTER 4 PAGE 19 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=19

CHAPTER 5 PAGE 23 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=23

CHAPTER 6 PAGE 28 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=28

CHAPTER 7 PAGE 32 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=32

CHAPTER 8 PAGE 37 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=37

CHAPTER 9 PAGE 44 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=44

CHAPTER 10 PAGE 55 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=55

CHAPTER 11 PAGE 65 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=65

CHAPTER 12 PAGE 75 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=75

CHAPTER 13 PAGE 87 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=87

CHAPTER 14 PAGE 98 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=98

CHAPTER 15 PAGE 110 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=110

CHAPTER 16 PAGE 115 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=115

CHAPTER 17 PAGE 125 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=125

CHAPTER 18 PAGE 131 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=131

CHAPTER 19 *FINAL UPDATE* PAGE 141 http://www.india-forums.com/forum_posts.asp?TID=3154269&TPN=141



Edited by titleepari - 08 November 2012 at 5:48am

The following 54 member(s) liked the above post:

cheeturagzs158advianyaANYA_29Sreeparvathyrapunzelgirlparulsri88cma_luvanyameenakshi.anyatitli22Neha07spdpmalini6941anjmuddParmasone-.Neha.-neelima_menonRano_rockkpm_madhuganganavyabanfashaappu_12Shaya_123smivasAishwarjyacrazzymoonjc_2312Richa_shamyabharathi.ksmevanpasihaseennancynnvgowripriyashahzTrulyAdoreSomyaMeghAn_AnYaFanSeenavasdivyasnsamruthasoniadutta--Sapphire--Kayal_SHAMYAannasweetyshamya-holicTacker_Holic-meru-Divi...A_SSanyadiv96__Neha__-Rashi-rashvinchandni4433f.s.mnavya19

Dear Guest, Being an unregistered member you are missing out on participating in the lively discussions happening on the topic "RS: Love Happens <3 *Completed* Index page 1" in Navya forum. In addition you lose out on the fun interactions with fellow members and other member exclusive features that India-Forums has to offer. Join India's most popular discussion portal on Indian Entertainment. It's FREE and registration is effortless so JOIN NOW!

Stepha_J

Senior Member

Stepha_J

Joined: 22 August 2011

Posts: 473

Posted: 18 August 2012 at 9:30am | IP Logged
I'm da 1st 1 2 cmntSmile awesme rs! Do cntnue sn w8n 2 rd da scnd part!

The following 1 member(s) liked the above post:

titleepari

titleepari

IF-Dazzler

titleepari

Joined: 30 January 2012

Posts: 3571

Posted: 18 August 2012 at 9:33am | IP Logged
Originally posted by Stepha_J

I'm da 1st 1 2 cmntSmile awesme rs! Do cntnue sn w8n 2 rd da scnd part!

thanx for the comment will continue soon..

Divi...A_SS

IF-Rockerz

Divi...A_SS

Joined: 19 November 2011

Posts: 9801

Posted: 18 August 2012 at 9:40am | IP Logged
meri bolti band hai yar titlee, excellent part of writing yar, juz wish tmls ka story be aisa hi ho.. anya's feelings r written in such a way tht i culd see all tht hpng in frnt of ma eyes.. i juz loved it.. zyada intzar mat kara yar, update soon..

Edited by -diva-shamya- - 30 August 2012 at 7:37am

The following 1 member(s) liked the above post:

titleepari

navya19

IF-Stunnerz

navya19

Joined: 20 January 2012

Posts: 34317

Posted: 18 August 2012 at 9:48am | IP Logged
Wow beautiful rs dear and loved the concept...waiting to read more

Edited by navya19 - 23 August 2012 at 8:48pm

The following 1 member(s) liked the above post:

titleepari

sweety71

IF-Dazzler

sweety71

Joined: 30 December 2011

Posts: 2521

Posted: 18 August 2012 at 10:01am | IP Logged
Very good concept.  May be this is the concept of Shaheer's upcoming TMLS.  Please continue.

The following 1 member(s) liked the above post:

titleepari

priyanka.710

Goldie

priyanka.710

Joined: 01 November 2011

Posts: 1981

Posted: 18 August 2012 at 10:05am | IP Logged
Superb titli.waiting 4 update

The following 1 member(s) liked the above post:

titleepari

titleepari

IF-Dazzler

titleepari

Joined: 30 January 2012

Posts: 3571

Posted: 18 August 2012 at 10:06am | IP Logged
Originally posted by sweety71

Very good concept.  May be this is the concept of Shaheer's upcoming TMLS.  Please continue.

Thanx.. :) yes i will continue soon.

Post Reply New Post

Go to top

Related Topics

  Topics Topic Starter Replies Views Last Post
LOVE LOVE LOVE...

2 3

Rachits 19 1249 20 November 2011 at 9:21am
By naveen_13
love u love u love from both :) Ramyachandran 7 660 10 November 2011 at 9:05am
By samratrocks
Navya love - Love at first sight Ya Attraction??

2 3

esha_friends20 19 1340 02 November 2011 at 9:01am
By SuperstarBarun
frnz hope TRP will be more in next index akshi-sidputul 4 546 01 October 2011 at 10:22pm
By luvarti
Love Tujhe Love...AnYa

2 3 4 5

Smita17 34 2067 23 August 2011 at 2:29pm
By MJHT24x7

Forum Quick Jump

Forum Category

Active Forums

Limit search to this Forum only.

 

 

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.