Channel V Dil Dosti Dance

India-Forums

   
Channel V Dil Dosti Dance
Channel V Dil Dosti Dance

~ Gopiyaan Taarein hain Chand hain Radha ~

Snigs. IF-Sizzlerz
Snigs.
Snigs.

Joined: 08 February 2012
Posts: 19719

Posted: 10 August 2012 at 7:20am | IP Logged

Title name is taken from the lines of Radha Kaise na Jale sequence.

Radha Kaise na Jale performance reminds of our sweet come hot Kriyaansh, their dori scene, Kriya jealous when the girls hold Rey and pull him off. Kriya's expressions were worth-watching and then followed by Kriyaansh Radha Kaisa na Jale. 

Happy Krishnashtami...always remember Kriya is the only moon of Rey while the others r stars!!

Share ur reviews on Radha Kaise na Jale sequence...Kriya's jealousy n dori scene.

                         Credits 2 Siggy :- dangerousishk




Edited by snigdha_arsha - 10 August 2012 at 7:23am

The following 42 member(s) liked the above post:

putrinurskreyaritsranveermalificientroshnithedivaMahirahkriyansh19pinkypanrocksswaron19Satluvsd3jainnehaArdour.-Pia-Jeeya_AngelJ-chan--RAINA----Ritu--StolenKiss.HPmaniacArShaAngelsHPHolic-3.Comics_Music.-bornalee-enriquerIDhid3rox-Nia-nj_SRKholicsapnaarshaKR_anki_ArSha-FrozenRain-moon_cupcakekuhu_Arshaluv_arshaZehnaseeb.KriYaansh960-Sara.crazyskyEndurancenature2-Ocean.eyes-..Rish..-PyaariBhootni-

Endurance IF-Stunnerz
Endurance
Endurance

Joined: 03 August 2011
Posts: 29796

Posted: 10 August 2012 at 7:24am | IP Logged
res 

unres jeee...LOL
 

I love this line of the song...

"Gopiyaaan tarein hain chand hai Radha..." 

Rey expressed these lines in his dance so beautifully and Kria jealous aweee that was the best ...

N the dorrie scene haaaye that to killed me... Kriyaansh one of the best scene ..and one of the few scenes where Rey expressed his feelings to Kriya directly without any hesitation ...even their performance was late cuz of their romance...LOL

Pure feeling were reflecting from their eyes during  this scene...

Meow i loved this topic on Janam ashtimi ...

Happy Janamshtimi to all of u ...


Edited by Angel56 - 10 August 2012 at 7:29am

The following 7 member(s) liked the above post:

ritsranveerArShaAngelsKR_anki_ArShacrazyskykuhu_ArshaZehnaseeb.Snigs.

Snigs. IF-Sizzlerz
Snigs.
Snigs.

Joined: 08 February 2012
Posts: 19719

Posted: 10 August 2012 at 7:32am | IP Logged

I loved Kria's expressions n comments when she was standing behind d door.

Especially this line, "Inhone ne toh Rey ko aise pakadke le ja rahe hain jaise uske koi personal property ho".



Edited by snigdha_arsha - 10 August 2012 at 7:35am

The following 7 member(s) liked the above post:

ritsranveerHPHolic-3KR_anki_ArShakuhu_ArshaZehnaseeb.crazyskyEndurance

Zehnaseeb. IF-Sizzlerz
Zehnaseeb.
Zehnaseeb.

Joined: 29 October 2011
Posts: 13116

Posted: 10 August 2012 at 7:39am | IP Logged

happy Janmashtimi Meow n everyone..

n now to the performance, it was one of the most elegant performances of D3..

i love the song only becoz of KR..

n yea, ur one line says it all:

"always remember Kriya is the only moon of Rey while the others r stars!!"

that's what KriYaansh are n will always be..

The following 5 member(s) liked the above post:

KR_anki_ArShakuhu_ArshaSnigs.crazyskyEndurance

crazysky IF-Sizzlerz
crazysky
crazysky

Joined: 27 May 2011
Posts: 10808

Posted: 10 August 2012 at 7:40am | IP Logged
hayeDay Dreaming...
snigu love u..Hug

...happy janmashtmi...

truely said...
n loved the dialogs u included in the audio...Day Dreaming

n u know what whole kriyansh scene is rewinded like a movie in front of my eyes..Blushing

they r perfect radha krishan..

as rey is like krishan n kria is radha...

"dharti pe nahi.. swarg mein hai inka milan.."

The following 4 member(s) liked the above post:

KR_anki_ArShaZehnaseeb.Snigs.Endurance

KR_anki_ArSha IF-Rockerz
KR_anki_ArSha
KR_anki_ArSha

Joined: 08 April 2012
Posts: 7381

Posted: 10 August 2012 at 7:40am | IP Logged
Happy janmashtami...Hug
first of all siggie is awesome...Clap
and i love your post's name...Heart
kriya is and will always be the moon for rey...

and their dance and dori scene...Blushing
kriya's jealous expression and shirtless rey...Blushing
omg love kriyansh...
thanx for this post snigdha...Hug

The following 4 member(s) liked the above post:

kuhu_ArshaZehnaseeb.Snigs.Endurance

Endurance IF-Stunnerz
Endurance
Endurance

Joined: 03 August 2011
Posts: 29796

Posted: 10 August 2012 at 7:42am | IP Logged
Originally posted by snigdha_arsha

I loved Kria's expressions n comments when she was standing behind d door.

Especially this line, "Inhone ne toh Rey ko aise pakadke le ja rahe hain jaise uske koi personal property ho".

sachi main Kria was so jealous at that time but yahee to pyaar he re ...Kria's expresiion were just WOWWW...and Rey haye his cuttie cuttie expression were just out of this world...Big smile

The following 3 member(s) liked the above post:

KR_anki_ArShaZehnaseeb.Snigs.

Snigs. IF-Sizzlerz
Snigs.
Snigs.

Joined: 08 February 2012
Posts: 19719

Posted: 10 August 2012 at 7:51am | IP Logged
" Aaj chahe jithne compliments dhun sab kam hain"



This siggy I got for Chasing Midnight FF and Im using it now..


Edited by snigdha_arsha - 10 August 2012 at 7:58am

The following 7 member(s) liked the above post:

Ardour.--Ritu--ArShaAngelsKR_anki_ArShaluv_arshaZehnaseeb.Endurance

Go to top

Related Topics

  Topics Author Replies Views Last Post
Ek dazzler and weakling date kan sakte hain, KRIYA

Author: KreyaArshiLover   Replies: 4   Views: 762

KreyaArshiLover 4 762 06 December 2011 at 6:12am by prrk86
In LOVE with OUR D3 Ke RADHA KRISHNA !!!!!

2 3

Author: Infinities   Replies: 22   Views: 3248

Infinities 22 3248 04 December 2011 at 5:15am by ..Rish..
NEW PROMO: RADHA KAISE NA JALE

2

Author: ~~ MICK ~~   Replies: 15   Views: 1683

~~ MICK ~~ 15 1683 03 December 2011 at 1:49pm by Tabzy
Itna sanata kyun hain Bhai?

Author: KreyaArshiLover   Replies: 2   Views: 497

KreyaArshiLover 2 497 18 November 2011 at 11:06am by _sana.Magic_
Humka pini hain

Author: TaShi_4ever   Replies: 7   Views: 1141

TaShi_4ever 7 1141 09 September 2011 at 4:36am by asmuasmi

Forum Quick Jump

Forum Category / Channels
Forums

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index