Iss Pyaar Ko Kya Naam Doon

India-Forums

   
Iss Pyaar Ko Kya Naam Doon
Iss Pyaar Ko Kya Naam Doon

OS-; FUN IN THE RAIN

tinsel_akira Goldie
tinsel_akira
tinsel_akira

Joined: 08 June 2012
Posts: 2091

Posted: 10 August 2012 at 1:11am | IP Logged

Fun in the rain...

 

Arnav was busy typing on his laptop while Khushi was reading a magazine gloomily.

Khushi-; ohfo this laad governor, he's so engrossed in his work that he cant see his wife is getting bored.

Arnav heard this and smirked. Suddenly it started raining outside and Khushi was looking at the poolside with longing eyes. Arnav saw this and he got a plan.

He went to Khushi and picked her up in his arms.

Khushi-; Leave me Arnav. What are you doing.

Arnav-; ssshhh... I think you said you were getting bored. So lets have some fun then

He took her outside to the pool and dropped her in the pool takind care not to hurt her. Khushi was shocked by this.

Khushi-; What did you do Mr.Raizada.

Arnav-; Khushi cant you be silent.

Saying this he himself went into the pool. Pulled Khushi towards him and crashed his lips on hers. They shared some time feeling themselves in paradise when Khushi came out of the trance and pushed Arnav with a glint of mischief in his eyes.

Arnav-; What the.. Khushi!

Khushi-; What, what the what the what the, don't you have any other work then this one.

 She said this with a fake anger and moved towards the end of the pool. Arnav thinking that she was angry went towards her to pacify her.

Arnav-; I am sorry Khushi. I jst wanted to have some fun.

He was standing at the back of Khushi when suddenly he felt splashes of water coming towards him.

Arnav-; Stop it Khushi.

Khushi said laughing-; No Mr.RAIZADA , this is your punishment for dropping meb in the pool.

Both of them slpashed water over each other and enjyed themselves.

Arnav-; Well I guess, this much fun is enough.

He said listening to Khushi's sneezes.

Khushi-; No please I want to play more.

Arnav-; No Khushi, see you have got cold now move inside right now.

He picked her up in his arms and left her near the bathroom door.

Arnav-; Change your clothes Khushi.

Both of them changed their clothes and were sitting on the bed when Anjali was passing by their room. She heard sneezes coming from the room. She knoched on the door.

Anjali-; chotte, is everything fine.

Arnav got up and opened the door.

Arnav-; yeah di achooo...    everything is fine. Achoo...

Anjali-; but then why are you both sneezing.

Khushi-; woh di actually achoo... achoo.. wewere both playing in the water.

Anjali-; And whos idea ws this???

Khushi-; Arnav's

Arnav-; Khushi's

Both of them replied at the same time. Anjali let out a giggle hearing this.

Anjali-; you both really behave like kids. Both of you wait here and I will make hot karha or you.

Saying this she left and both Khushi and Arnav again got in a argument deciding who' idea it was.

I know it sounds a bit lousy but it was just a random thought.

Try my other works on Arshi-;

OS  THE CUTE SURPRISE-; http://www.india-forums.com/forum_posts.asp?TID=3131975

SS I AM SORRY!! -;  http://www.india-forums.com/forum_posts.asp?TID=3053892&PID=59642213&#59642213

The following 54 member(s) liked the above post:

va20171jaasz_25shy_chickbarathjoyceJanhviGbrightstarsweetdarkangelptingtingkammy63inluvwivARHIrajalekshmistarandrainbowazizeh123TinkJiaRihana5rosefan09DarkBecominganumeha_PMsamspriyanka09..Raizada..Arshi94hiraariflovebadhanSAM32iLuvYellowRandomGirlgom3090vikadesigirlavantika_2012Avi64priyankaakajolkonnaarniepervaiz1DAliceBonhi_ipkkndsanny-beautifulAbi.NadevishreeMISTIEashred12zafistar_fan1misscrazyfanArshifan4lifethulasi_arshiajoopDhaakadAngel13OmNaMaSteOmdrunkiiebabekeenu_kkmishti_17chavvi16Arshi.Sugi.IPK

mishti_17 IF-Stunnerz
mishti_17
mishti_17

Joined: 07 November 2009
Posts: 28536

Posted: 10 August 2012 at 1:30am | IP Logged
Aww.. So cute.. <3
kajolkonna Goldie
kajolkonna
kajolkonna

Joined: 03 January 2012
Posts: 1749

Posted: 10 August 2012 at 1:32am | IP Logged
So cute.
rukuswasthika IF-Sizzlerz
rukuswasthika
rukuswasthika

Joined: 14 October 2011
Posts: 12176

Posted: 10 August 2012 at 1:38am | IP Logged
so cute
srilu_123 IF-Rockerz
srilu_123
srilu_123

Joined: 07 January 2009
Posts: 6363

Posted: 10 August 2012 at 1:44am | IP Logged
awesome
.MyriadOfHues. IF-Stunnerz
.MyriadOfHues.
.MyriadOfHues.

Joined: 09 April 2012
Posts: 34728

Posted: 10 August 2012 at 1:44am | IP Logged
That was too cute! <3
arniepervaiz Goldie
arniepervaiz
arniepervaiz

Joined: 30 January 2012
Posts: 2246

Posted: 10 August 2012 at 2:22am | IP Logged
it was very cute..loved it..
Avi64 Goldie
Avi64
Avi64

Joined: 01 April 2012
Posts: 1074

Posted: 10 August 2012 at 4:57am | IP Logged
that was very cute yaar! at least someone's poot that jakuzi to some useTongue

Go to top

Related Topics

  Topics Author Replies Views Last Post
ArHi Rain Sequence

2 3

Author: Khilonaa   Replies: 18   Views: 3874

Khilonaa 18 3874 21 November 2011 at 9:06am by Khilonaa
Can we have a rain and dance scene

Author: looser01   Replies: 2   Views: 1003

looser01 2 1003 26 October 2011 at 11:56am by Millerrr88
ArHi's Rain Dance :)

2 3

Author: Sanlicious   Replies: 19   Views: 3219

Sanlicious 19 3219 12 October 2011 at 9:41am by RiyaDutta
Arhi in rain

Author: _mehak_   Replies: 9   Views: 1815

_mehak_ 9 1815 08 September 2011 at 7:48am by asmuasmi
So arnav left khushi in the rain

2

Author: butterfly06   Replies: 12   Views: 2604

butterfly06 12 2604 07 September 2011 at 11:58am by lara3110

Forum Quick Jump

Forum Category / Channels
Forums

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index