Diya Aur Baati Hum


DABH WU 2nd Aug. '12 Sandhya Teasing Suraj

Post Reply New Post

Page 1 of 3

Page 1
Page   of 3
Page 2 Page 3




Joined: 27 August 2008

Posts: 40354

Posted: 02 August 2012 at 11:00am | IP Logged

The girl give dress to suraj n says that his wife gonna love it n hug him, suraj shy n smiles n that girl hugs him n sandhya came from behind, n gave expression as if she dnt like it n leaves. Suraj got scared n follows sandhya to explain, but she was only doing masti, she dnt listen him, he was trying to explain that he was buying dress for her n that girl hug her, sandhya turn her face n gave a wicked smile n leave, suraj still follows n show her the bags asking to check the dress for her but she ask to gave it to that lady only n leaves, suraj was confused that y he show this dress to her, he was only explaining that its for sandhya, but she dnt listen n leaves.

Other side, mina was making sudha ready with saree n lots of make up, she had a plan that she'll send rajkumar inside to check the bulb n then she have to impress him, mina take out the bulb n it was dark, she goes outside n saw raj with  Chaturi n dnt like it, she calls raj n ask to change the bulb, he goes to change it.

Scene changed, babasa n suraj were ready n waiting for bhabho n sandhya outside party hall, suraj thought that sandhya is still angry thats y dnt cmg, babasa says that in India thr wives wait for them n here thy r waiting for them n bhabho came out of lift but she was alone n suraj was looking for sandhya, bhabho understands n says that she dnt order her to clean the hotel, she might be cmg not to wrry n sandhya came, bhabho babasa leaves them alone n head inside party hall.

 Sandhya was not talking to suraj, he was searching sum bahana to talk, sandhya understanding her desperation but wanna tease him more, suraj opens his tie n says its tight n ask to fold it again n came closer, she take it n fold it on her neck n gave him back, he was confused, sandhya again smiled secrectly n leaves, suraj follows to manofy her.

Other side, raj enter the room n as it was dark he fall n saw sudha in dark, she was looking scary due to dark makeup n he shouts, bhoot bhoot, all came inside n mina switch on lites n saw sudha in dark make up, chavi n chaturi laugh looking at her n make fun of her, mina ask to leave all.

 Scene changed, bhabho n babasa enter the hall n were surprised to see couples dancing, babasa offers bhabho for dance but she denies, brandal came hugs bhabho again n again n ask abt his dress, bhabho getting irritated n leaves alone, he hold babasa for dancing but he too leaves soon.

Suraj n sandhya enter the hall, suraj was continuosly trying to talk but sandhya intentionally ignoring, suraj was following her here n there, a lady hold suraj for dancing, sandhya smiled n suraj was uncomfortable, he leaves soon.

 Babasa saw food n calls bhabho but she denies to eat as its her fast of teej, suraj heard it n says that Sandhya might also dng fast, she heard it n hold plate for teasing him as if she was eating, suraj found it suspicious n take hary's help, hary goes n ask sandhya to taste fod for her but she denies n then suraj insist n she confess that she was teasing him n then suraj gift her the dress.

 Precap: Bhabho ate wine mix dish by mistake.


Edited by BhartiKhushi909 - 02 August 2012 at 11:16am

The following 104 member(s) liked the above post:

*Shruti*vandana.bandaruNas1Sejal_Desaiindy1979sueclifetimefanrohini_2007metallicazShahinakhcoolxniki_pngujaratigirlshalininarangpragyakumarswarajgirJANNAVeshachparbhudayaltau123anna_88ssprsdshiny3skapu80visha1314pavneetnani2011payalstar432fym23oceanbreeze11Nisha_abiphloxyBlacksexyspicygiguserpraman1234shanthagp05pgshahzackghoneybeeeaasaxena3ivanta29archie76shabana_79asiaheartsharmilident4uRaima36Anfalneucharijolly_flanky_1205A HUGE FANnanda_gopalukin4goodSoapPappu.Shilalipiluvabhiya9sunshine33bud2012sadhana1234sati65apkavishwamariam42b2011-Ritu567--Muskii-hariniatptimepassnavyaalex8shehjarcoolmausamDEBOLINA96c3ciliazulfy_135shwetha85my_viewabi71svijaya77irene_cFizakneel_jaypoo_supi-Ramya-sweetysarannancy1996Manjuuadi_guptapiyualkatalkie14deejagirekrnnirubaGautam_JenniferTacker_HolicHi_FriendsnithyamkvTazinSushantFanMallika113t_areeb-Liebe-ummesulaimanSAIBALROUTH-Amli-

Dear Guest, Being an unregistered member you are missing out on participating in the lively discussions happening on the topic "DABH WU 2nd Aug. '12 Sandhya Teasing Suraj" in Diya Aur Baati Hum forum. In addition you lose out on the fun interactions with fellow members and other member exclusive features that India-Forums has to offer. Join India's most popular discussion portal on Indian Entertainment. It's FREE and registration is effortless so JOIN NOW!




Joined: 30 March 2010

Posts: 1927

Posted: 02 August 2012 at 11:01am | IP Logged
Thanks for the quick WU Khushi..I am expecting some really funny sequence tomorrow after reading the precap OMG Bhabhoo...LOLLOL Glad that the sandhya chidafying sooraj with teej vrat scene was shown today..Excited and waiting for evening so that I leave from here..head home to watch DABHLOLWinkBig smile

Edited by shwetha85 - 02 August 2012 at 11:20am

The following 7 member(s) liked the above post:





Joined: 11 January 2007

Posts: 5536

Posted: 02 August 2012 at 11:17am | IP Logged
thanks. I missed the epi

The following 5 member(s) liked the above post:





Joined: 13 December 2010

Posts: 14580

Posted: 02 August 2012 at 11:18am | IP Logged
Thanks for the update. Smile
Hilarious Precap. ROFL

The following 4 member(s) liked the above post:





Joined: 10 January 2012

Posts: 11246

Posted: 02 August 2012 at 11:33am | IP Logged
Thanks for the in-detail WU..Hug

Precap:- Bhabho at her best with facial expressions in drunk state..ROFL

The following 5 member(s) liked the above post:





Joined: 18 October 2011

Posts: 1141

Posted: 02 August 2012 at 11:40am | IP Logged
Thanks for update!

The following 5 member(s) liked the above post:





Joined: 03 January 2011

Posts: 9972

Posted: 02 August 2012 at 11:42am | IP Logged
Thanks Bharti for the update.
What's gonna happen tomorrow!!!! Reminds me of Meena-Bhabho scene during holi bhang scene ROFL ROFL 

The following 4 member(s) liked the above post:





Joined: 29 January 2005

Posts: 2296

Posted: 02 August 2012 at 11:52am | IP Logged
thanks for the update!!!
hippy tommorrow in drunken state Bhabo might say unexpectedly to Bhabasa or else she start dancing...ClapBig smileWink

The following 4 member(s) liked the above post:


Post Reply New Post

Go to top

Related Topics

  Topics Topic Starter Replies Views Last Post
Diya Aur Baati Hum Forum Help Desk

2 3 4 5 6 7 ... 78 79

-Rumi- 628 44402 7 days ago
By aroojakhtar
ll DABH Introduction corner ll

2 3 4 5 6 7 ... 27 28

-Rumi- 218 24361 04 January 2014 at 4:16am
By MR21
ll DABH Creations Corner ll

2 3 4 5 6 7 ... 148 149

-Rumi- 1187 110924 17 April 2013 at 7:53am
By -Anaya-
ll DABH Picture Gallery ll

2 3 4 5 6 7 ... 149 150

-Rumi- 1198 242146 20 December 2012 at 12:27pm
By SuryaNakshholic
DABH TRP Thread !! DABH @ 27

2 3 4

tanthya 29 4274 02 August 2012 at 4:33am
By soomaarao20

Forum Quick Jump

Forum Category

Active Forums

Limit search to this Forum only.



Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.