Iss Pyaar Ko Kya Naam Doon

India-Forums

   
Iss Pyaar Ko Kya Naam Doon
Iss Pyaar Ko Kya Naam Doon

Arnav and Khushi leave RM now

arnav101 IF-Dazzler
arnav101
arnav101

Joined: 11 April 2012
Posts: 3039

Posted: 20 July 2012 at 8:55am | IP Logged
I cant believe it, i m having pity for my ASR. This guy just cant have a life of his own. Anjali again Blackmailing Arnav to bcm ASR. And this time i dont feel pity on any1 bt Arnav. U say Khushi is getting hurt what for a year.
anfd Arnav well over 20years. Today i realized how pity and helpless Arnav was for this many years 

SO, I want ARNAV and KHUSHI to Leave RM now now now. Then ARNAV can do all these sweet stuff He done today. I just Loved Arnav today. Thats why my anger is at control 

## ALL my anger to u ASR is gone and only pity is left for u as u have gone through HELL these long years, Sry to be mad on u ASR. LOVE U ARNAV

some IF members reply that express my feelings as well

Originally posted by psychopinks

yep defo agree with you! This is the only solution - they just need to leave! 

Anjali, I'm sorry I felt slightly bad when Daljeet was talking about her character in her interview but urgh, seeing Anjali take her anger out on Arnav just really annoys me. If she really can't deal with the situation maturely why doesn't she go look for her scumbag of a husband instead of go to the hospital and try to kill her unborn child. She says Arnavs changed but hasn't she? She doesn't seem to care that everything she's doing is hurting him, she doesn't seem to realise how emotionally conflicted he is because of her. She's saying that he's fell in love almost accusingly, so he isn't allowed to fall in love? He's tormented the woman that he loves time and time again because of her and I just get the feeling that she wants him to continue. She's just dumb! She needs to get a brain or just get out. Or maybe Arnav should pay some money to get her shown to a psychiatrist because well clearly she needs one right now. 

You are right when you say she wants him to turn back into ASR. Because she knows Arnav won't follow her every little command and just look after her constantly. It's as if she can't stand the fact that he can't devote his whole life for her. 

I really can't find sympathy for her, no matter how depressed or broken she may be. She had so many clues in front of her and she chose to ignore them over her blind love for her good for nothing husband and now wants to blame Khushi for everything. 
And that mamiji is the other one - she's the reason for causing this problem with Arshi again as well!

Either Arshi need to leave or Arnav needs to kick the rest of them out!
 


Originally posted by priasweet

exactly agree with u but i always support arnav 
whenever he is mad at khushi or others i always think its his nature because to keep his family and so called selfish di happy and provide them their needs he kept his emotions and happiness and feeling within him and turned into ASR. but khushi changed him into arnav and he became so lovely and always smiling boy soon due to that shyam everything crashed and now when he is again becoming arnav everyone are giving pain to him. i even think khushi is doing the same. she thinks of her sister and anjali why can't she accept arnav's love and lead her life also. she tried to unite payash but she isn't thinking to live her life with arnav. poor boy. she should love him and support him and always be by his side. she should stop thinking of others and live her life. 
all raizada think only about their anjali but what about arnav he has been kidnapped did anyone speak about it after that incident. no they care only for anjali. poor boy always he is being support of others but no one is there to support him. his di is only to emotionally blackmail him.
he should leave RM and stay in separate house with his love in peace. no disturbance. 
  

Originally posted by ASRsweetKKG

about leaving i am not saying anything right now..coz i dont think this RM damn people leave them alone..Angry.i'll say something after yesterday's episode... 

let me ask...wat the hell is going on actually...?Angry
yesterday Anjali was saying u changed chotte ...!!!wat does tat mean..?Angry

but actually Anjali is the one who changed...not Arnav...Thumbs Up
Anajli is the one who was the one who tried 2 make them together, Embarrassedshe was the one who made baali honeymoon & told them 2 enjoy their honeymoon at its peak, Embarrassedshe was the one who said khushi 2 repair ASR's button & left them alone Embarrassed, she was the one who said arnav 2 care 4 khushiji Embarrassed& make him realised tat how much he cares 4 khushiji in front of the mirror, Thumbs Up
is tat the same Anjali..???????Confused
if she was fine & didnt hav any problem tat time then y should now????????Angry

yesterday she said 2 him tat u wanted 2 spent time with khushiji...Dead
if he wants 2 spent some time with his wife wats the problem..?and obviously he has 2 change after marriage...he cant sit with anjali 24*7 time near 2 her bed & make her sleep by singing ballads...Ouch
she was saying "u r in love now" ...so wat??????? cant he?????Dead
anajli was in love with her spouse ...and ASR too...wats the big deal|???Angry
so she dont want her chotte in love ?she wants 2 make him angry ASR & only sweet with Di???Shocked
just pissed off man...seriously just pissed off with this whole RM family except nanijji...
its better 2 bear the snakewaa i think.Angryomg..he was far better i think!!!!.AngryCry


__________________
 

Edited by arnav101 - 21 July 2012 at 2:48am

The following 78 member(s) liked the above post:

komaltahsinLuvlin28jayagowrianjaanichokriarshirabelakansharaizadacelaxnedramaniszszsedward420sammi5KamalikaGbabli0204Archu61Brashti24craziefanDasGHjazzpreetgkoolansun.complicatedLoveRomance0asumasanMahi_Buttarshi1986luckyarnavNasraManchilahitinikkijennadaminta13dorindakatepriyankaaheavenspiritsaddafmahmoodbijiliSaraJLAcnavneilRemovednotacrimetolovestarplus31hkhb17Forumuser_sun2011kitty25yongshinSarun_4ever-Superstar-lovearshi01TheCaptainswetha_chAparamegha.sariminoz.sreemeeraAfyavellainsaansimran04ipkkndfanforevaarshistargmgisikhni_star_fan1saima4744zafigogumaarshi_karishpriasweetpisces25MrDarcyfanOnepoundChicragvir.fanDivya1503ajooptvpal007-ElmoFuj-silvia1999MihrimahArnieBoyBarunxAaliya

arnav101 IF-Dazzler
arnav101
arnav101

Joined: 11 April 2012
Posts: 3039

Posted: 20 July 2012 at 9:03am | IP Logged
Unbelievable, after today i cant imagine a rain sequence or any Love scene 

really Anjali and Family really 

The following 11 member(s) liked the above post:

komaltahsinLuvlin28jasminsandrilaaminta13diya33priyankaa-Superstar-arshi_karishsaima4744ragvir.fanxAaliya

arni123 Senior Member

Joined: 25 June 2012
Posts: 378

Posted: 20 July 2012 at 9:10am | IP Logged
THE ACCOUNT OF THE MEMBER WHO POSTED THIS MESSAGE HAS BEEN TEMPORARILY BANNED.

If you think this is an error please Contact us.

The following 5 member(s) liked the above post:

arshirabeldorindakateDasGHarshi_karishMrDarcyfan

TheCaptain IF-Dazzler
TheCaptain
TheCaptain

Joined: 26 August 2010
Posts: 3392

Posted: 20 July 2012 at 9:11am | IP Logged
Arhi, Payal, and NK should leave RM. now. 

The following 11 member(s) liked the above post:

arshirabelkrajluckyarnavdorindakateDasGHpriyankaasun2011sreemeeraarshi_karish.Kiran.ajoop

arshi_karish IF-Rockerz
arshi_karish
arshi_karish

Joined: 30 August 2011
Posts: 7314

Posted: 20 July 2012 at 9:12am | IP Logged
so true yaar..bechara...Cry

The following 1 member(s) liked the above post:

arshirabel

arnav101 IF-Dazzler
arnav101
arnav101

Joined: 11 April 2012
Posts: 3039

Posted: 20 July 2012 at 9:13am | IP Logged
Originally posted by arshi_karish

so true yaar..bechara...Cry


yes, He was blackmailed he Gave every1 a good life and Himself lived in HELL. 


NOW Arnav & Khushi leave RM now now now 

The following 5 member(s) liked the above post:

arshirabelarshi1986dorindakatepriyankaasreemeera

arnav101 IF-Dazzler
arnav101
arnav101

Joined: 11 April 2012
Posts: 3039

Posted: 20 July 2012 at 9:14am | IP Logged
Originally posted by ArhiSuryaRanya

Arhi, Payal, and NK should leave RM. now. 


yes,  they should do it now. those leachers leached over Arnav for a vary long time 

The following 2 member(s) liked the above post:

dorindakatezafi

*mad* IF-Rockerz
*mad*
*mad*

DSK & GES Banner Contest Winner
Joined: 01 November 2006
Posts: 5244

Posted: 20 July 2012 at 9:15am | IP Logged
I felt sorry for him when he watched both of his ladies walk away from him..
then i got angry since he ran behind his sister and didnt even look for his wife

The following 9 member(s) liked the above post:

arshirabelkomaltahsinLuvlin28jasminsandriladorindakatesun2011sreemeerazafiJohny.S.Raj

Go to top

Related Topics

  Topics Author Replies Views Last Post
Shyam gets torture by Arnav-Arnav kidnaps him!

2 3 4 5 6 7

Author: Khilonaa   Replies: 49   Views: 39126

Khilonaa 49 39126 03 November 2013 at 10:04am by imama13
'Khushi, Khushi, Khushi' - Arnav

2 3 4 5 6 7

Author: minuu   Replies: 49   Views: 44958

minuu 49 44958 17 May 2013 at 10:41am by .Brooke.
Naina's VM Gallery / Aas Paas Khuda *New*

2 3 4 5 6 7 ... 16 17

Author: Enigma.   Replies: 133   Views: 36249

Enigma. 133 36249 15 September 2012 at 1:24pm by Maha149
Arnav and Khushi marry on La-arnav engagement

2 3 4

Author: butterfly04   Replies: 30   Views: 23006

butterfly04 30 23006 16 August 2012 at 9:46pm by mindit1234
arnav arnav n arnav

2

Author: bidyabati   Replies: 14   Views: 11279

bidyabati 14 11279 23 May 2012 at 1:47am by Arushee

Forum Quick Jump

Forum Category / Channels
Forums

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index