Iss Pyaar Ko Kya Naam Doon

   

IPKKND-19thJun12-Video+ESubs+E24+SBB+SBS *HDQ*

Post Reply New Post

Page 1 of 4

Page 1
Page   of 4
Page 2 Page 4

-Nipun97-

IF-Stunnerz

-Nipun97-

Joined: 04 July 2006

Posts: 36011

Posted: 19 June 2012 at 9:28am | IP Logged

THIS IS A "MEMBERS ONLY" POST


The Author have chosen to restrict the content of this Post to Members Only.

New Visitors Register Now to view the content of this post. As a member you will also be able to participate in our discussions and its FAST & FREE!

Members, please Sign-In.

If you are a member and already logged in. Please hit "Refresh" on your web browser as it might be showing you the cached copy (from previously saved file from Temporary Internet Files).

The following 32 member(s) liked the above post:

archu_2010haarisarhi77Arshi_AmazingsooocuteLiveup59soreya20marrtymistyeyesshinedosssdent4ugilgameshchanloves-JB_1DJust_LoveRiaSheikhrina25mjhtian94peachpie-mesmerised-JUHI.HIshilparoxxwonderblakePunkin22xMidnightStarxOmaRamdassgogumaVarunKiBiwiImziLyssaPieaartipartyyArshi.Sugi.IPKbones88

Dear Guest, Being an unregistered member you are missing out on participating in the lively discussions happening on the topic "IPKKND-19thJun12-Video+ESubs+E24+SBB+SBS *HDQ*" in Iss Pyaar Ko Kya Naam Doon forum. In addition you lose out on the fun interactions with fellow members and other member exclusive features that India-Forums has to offer. Join India's most popular discussion portal on Indian Entertainment. It's FREE and registration is effortless so JOIN NOW!

chanloves-JB_1D

Senior Member

chanloves-JB_1D

Joined: 11 May 2012

Posts: 421

Posted: 19 June 2012 at 9:54am | IP Logged
hey ipkknd and arshi fans...
that was an amzin episode and sbs...poor arnav and khushi...hope they get back together soon...
arnav looks so fit and khushi is so preetySmile
here is my prediction of what could happen...
Arnav is free from the kidnap and finds out about the papers and the blame goes on khushiSleepy...he believes shyam and hates khushi..shyam gets in jail but escapes and gets hold of anjai and khushi... his motive know is to get revenge from khushi and arnav.. he wants to get hold of the riazada property at aby cost and do what ever he can do..
He phones and blackmails arnav and says ''give me the property or i will kill anjali... she is in my custudy alond with your love..khushi kumai gupta'' and laughsLOL
Arnav is really arngy and throws everything as his ''DI'' is with shyam... He gets the papers ready and goes to realese anjali..he goes in the hidout and gives the papers to him and says hand over anjali..shyam goes
''no... you have known me for ages know...you should know what i do to people when they don't give me what i want''
He shouts bring them both in'' these other goons bring anjali and khushi in there and arnav has the shock when he sees the state of anjali and espeacialy khushi's. They are both bruised and khushi has rough marks on her hands and blood marks on her head... Arnav gives shyam the papers and saya'' please, now give me di back''but as shyam is evil he says '' Fine you can have your speacail di back...but her dead body...i am gonna kill her as i hate her and want revenge from you... i hate all of you.. and i will not let you rest in peace'' i will first start my revenge from you arnav by killing the person you most love.. DI''
He points the gun towards anjali and says ''this is the time to say your goodbye's... sorry but i will shoot you twice..one bullet for you and the other for the baby'' Anjali cryies.Cry arnav shouts..''DON'T YOU DARE!'' Khushi goes ''please shyam don't do this..don't kill anjali ji..'' Arnav pushes khushi and angrily says''don;t show your false consern now...this is all you fault...i hate you. Khushi is really hurt by these words and says ''arnav ji please beilive me..i never wanted this to happen.. i am innocent..its all shyam..please trust me'' Arnav-'' Enough of your lies... i hate you even more.. i never want to see your face ever again.. just leave from here.. you never were a part of my life... it makes no difference to me if your allive or DEAD..out of my life and never come to me again... I HATE YOU!''
kkg bursts into tears and is hurt so much..
shyam points the gun at anjali and shoots arnav shouts''DI''..but khushi comes in the way to save anajli and gets the shot herself.'' BANG BANG..everyone is shocked shyam goes what...ecspeacilay arnav. he is shocked at why khushi saves anjali.. anjali goes to khushi and cries.. khushi puts her hand on her tummy and sees blood all aver her hand.. she looks up to arnav and painful tears roll down her cheeks... she falls to the ground and anjali goes why did you that...kkg goes 'your life is more valuable than mine...everyone hates me... there is no point of me living when no body wants me alive'' kkg breathes heavily and is crying with painCryarnav runs to her and holds khushi head.. and says '' khushi...khushi..you can't leave me like this... why did u do that?'' kkg goes-'' you always hated me right...you never wanted to see my face... you wanted me to leave your life and thats what i am exactly doing... i can't face your hatred for the rest of my life..while i have not done anything... arnav ji ..well your wish is coming true as you wanted to see my face...so i am going so far you will never have to see me... i am going to devimaya...''
but before i die please beileve me..i am innocent...i did not want the property''... arnav holds her hand and says'' khushi i did not mean it that ..you cab't die.. i cannot live without you.. I LOVE U... and holds khushi hand''
kkg goes- arnav ji...i love.. and is about to say you when her.. hand falls and her face fall from arnavs lap and she is unconsios...
everyone thinks she is dead and asr shouts ''KHUSHI''
shyam laughs and goes there is no point now as she is dead...she deserves it ...as she turned me down for you...ASR says ''what''? Shyam goes ''yes you heard right...khushi loves you not me...she was saying the truth all along... she is innocent and i am the EVIL one.''.
arnav starts to hit him...but anjali goes leave him chote...we must take khushi to the hostipal... then the police come and take shyam away.. arnav is shocked and has the guilt of his life...he looks at kkg and thinks how could i not belive her'' he takes her to the hospital
All of the family and khushi are at the hostipal..the docter goes we must do an operation ans she has lost lots of blood... asr is so sad and guilty
Everyone is cryingCry.. asr goes ''it is all my fault...i did not bileve her..''
the operation is over and the docter says ''sorry we could not save her''... asr prays to god for the 1st time and asks for khushi life... after a couples of moments kkg starts breathing and she is al right.. but is still injured. the docter goes you must not give her any stress and take good care of her..
arnav says sorry to kkg when she is awake and she forgives him and the love track starts...
Thanks for reading..
what do you think of my prediction... this is not going to happen.. but its my guess...please press the like button if you liked itSmile
Please comment and tell me your opinions and thoughts..
Do you want this to happen?
I LOVE U IPKKND AND ARSHI Heart

The following 12 member(s) liked the above post:

arshi.loverssarahkkhanmarrtyprinivalankansportyshinings_salekhdahiflufflesmariam42sanakhan4OLGNESOmaRamdass

xMidnightStarx

IF-Rockerz

xMidnightStarx

Joined: 26 February 2012

Posts: 9785

Posted: 19 June 2012 at 10:15am | IP Logged
Thank you!! :)

The following 2 member(s) liked the above post:

chanloves-JB_1DHeAvEnS

xsumi

IF-Rockerz

xsumi

Joined: 28 November 2011

Posts: 5654

Posted: 19 June 2012 at 10:28am | IP Logged
TFS

The following 1 member(s) liked the above post:

chanloves-JB_1D

Katelyn

IF-Rockerz

Katelyn

Joined: 08 May 2012

Posts: 6391

Posted: 19 June 2012 at 12:09pm | IP Logged
Thank you!! I can't wait to watch it with English sub.

The following 1 member(s) liked the above post:

chanloves-JB_1D

mjhtian94

Goldie

mjhtian94

Joined: 07 August 2010

Posts: 1417

Posted: 19 June 2012 at 12:32pm | IP Logged
thanks...

VarunKiBiwi

IF-Sizzlerz

VarunKiBiwi

Joined: 07 November 2011

Posts: 24474

Posted: 19 June 2012 at 12:36pm | IP Logged
Thanks for the links.

Baki

IF-Sizzlerz

Baki

Joined: 09 February 2011

Posts: 13545

Posted: 19 June 2012 at 12:40pm | IP Logged
It seems like we are getting an end to this kidnapping track, as Barun and Abhaas had done the fight sequence already.

Post Reply New Post

Go to top

Related Topics

  Topics Topic Starter Replies Views Last Post
IPKKND-13th July-Video+ESubs-OL/DL/Pic *DVDQ* -Nipun97- 8 2662 14 July 2011 at 12:20am
By sanw
IPKKND-12th July-Video+ESubs-OL/DL/Pic *DVDQ*

2

-Nipun97- 13 2411 13 July 2011 at 8:40am
By KiranSD1
IPKKND-11thJul-Video+ESubs+PRECAP-OL/DL/Pic *DVDQ* -Nipun97- 8 2388 12 July 2011 at 12:06am
By -AquaMermaiden-
IPKKND-8thJuly-Video+ESubs+PRECAP-OL/DL/Pic *DVDQ* -Nipun97- 7 2507 09 July 2011 at 7:26am
By -AquaMermaiden-
IPKKND-7thJuly-Video+ESubs+PRECAP-OL/DL/Pic *DVDQ* -Nipun97- 6 2997 08 July 2011 at 1:00am
By TheMiaw000

Forum Quick Jump

Forum Category

Active Forums

Limit search to this Forum only.

 

 

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.