Iss Pyaar Ko Kya Naam Doon


Iss Pyaar Ko Kya Naam Doon
Iss Pyaar Ko Kya Naam Doon

Top20IPK/Top100-ArHi/SaRun moments

JennyPenny IF-Addictz

Joined: 03 July 2005
Posts: 90665

Posted: 03 June 2012 at 11:31pm | IP Logged

After a long demand, Am making an index for this thread which is hard cause it's like on every page but here we go.

Page 1 - Scene 100, 99. 98 - for IPK, ArHi and SaRun ( due to time constraints in the middle IPK become only top 20, so read the 100 th scene as more like 20 and go that way).
Page 2- Scenes for IPK, ArHi and SaRun continues
Page 3 - More scenes follow
Page 5- bottom two posts
Page 6 - Scenes continued for all 3.
Page 7 - Continued...
Page 8 Continued
Page 10- continued
Page 11- continued
Page 12 -continued
Page 13- continued
Page 15- continued
Page 16 - continued
Page 17 - continued
Page 18 - continued
Page 19 - continued, the top 3 scenes

will be updated as soon as I can make them.. This is more like my list, and it's gonna be longgg.. well hope you enjoy this is for Gul, and the entire team - THANK YOU for IPK!

Top 100 scenes of IPK:
#100: Payal fights with Arnav when he brings back Khushi after guesthouse. The reason why it's an amazing scene is because we finally realize that Payal has a backbone. Of course after this scene, we never saw Payal ever having a backbone or ever fighting with someone. This scene is a favorite because not only did Payal fight with Arnav, but it also showed Bua's care. As the episodes progressed, we realized Bua loves Khushi more than Payal, but when her care came around, it was surprising since we felt that everyone but Payal and Shashi didn't give two toots about Khushi.

DISCLAIMER: Please don;t copy the caps/ sigs - they are only for the purpose of this thread and I am just coloring them and not putting my copyight on it.

Edited by khushix - 06 June 2012 at 11:30am

The following 191 member(s) liked the above post:

prathistharempySereniteSandeepikaNiidhiihelenMjayagowriburberry07insanity190specailgirlmariamtipkknd159pinkyasrandy_sydneyAanchal_desijattidarkangelpShikhaBarunfathimaa98bigtimeARSHIfancrazynainaJordinKZ1412ShyamukittyMissPunjabiniya_scinipaul101akshu0308mybro_2004labiCrazySaRunianinder1714Mishal4Sumudddee1001xotiknishtaSahana2irumnazstar1315Mizhimchandelx-nisNatachaarshi_forever9springatomsPreety_womanshona-liaruforarshiArshilovanyabellSu_SomerholicbarunxoxodedeepyalovepasbarunMaddyAddyanjusr06xoxo_BaruNialldreamymayablackdice1001nikolai_gogolbijiliyongshinShaily.nm21TangledpollypollyJasleenlivy..Anannya..shanthipriya-Sruthi-peachpieS.Stephyipkknd06ClaraOswald.nav_bat-Atiya-fly_dog..Damsel..shwetachauhanLumosMaximaaycma98arshiyanaNightingale...inshuuBarunkidewanitara_211SunriseGreenmomentsofme.reyaa.-sayeed-archie_79memories_imArshi_lovergal-FarwiiDobaara-Arshi1195arshisamairaLooneyLunaRashmiNMipkkndfanforevasimran04KatelynxMidnightStarxBarundeewani19Leah1-SnowKid-Aasthaherenishi_I-fianShiningStar18curledupxarmaanloverxzooni.blueBarishkiduaamysterieuxmoodie.foodieshona.OmaRamdassjessicad.Sam.CoolioqueenSupna9.lostinthought.JUHI.HILivingInPajamasstardust--Kanha-Alyaa_27Jyo.-Garima---sumana13--Sidda8.Mandy.shockalotscarlettebluepinky_blueskies* Unnati *..Sakeena..dangerouzIshk.anku-BlackStonesARJRANSIDVARSKyulZbookluvermomma1128mazkachazkauswahshootingstar.xx-Aliya-.Saraa.DiyaS...Pwincess...Mariaa.SG..Amina..RiyaDutta-Kina-.Kiran.OnepoundChic-ScarletRose-HSFA.Sad.But.True.incandescentaish.ChitraF.Jazz.silvia1999stg1MephistoTish_AniCATZ..LyssaPiesnoopy84chotte097MamiaRehmanaartipartyySimplypriceless-Deepali-Roshini1494BeingBlunt_TheJoker-riyya6.ayesha..JustaDreamSunshine Girlmishti_17anitamalik-LetItGo-khushixnikita_88HeavenlyBliss.minuu.Manal.Invoker

JennyPenny IF-Addictz

Joined: 03 July 2005
Posts: 90665

Posted: 03 June 2012 at 11:33pm | IP Logged
#100: (ArHi): The reason why this stands to be on 100th spot is there are too many and it's hard to pin it down. I really liked this scene, cause after all said and done, destiny brought them together, we got to see them clash with the sindoor, we got to see the insights of how much they hate each other yet cannot stay away. We gotta a chance to see Payal and Akash feelings a bit too, as well as Anjali-Khushi interaction and Tu hi bata mere maula in the background was a cherry on the cake!

The following 105 member(s) liked the above post:

helenMprathisthaAanchal_ipkknd159andy_sydneyJordinSahunalidarkangelpfathimaa98Preety_womanbarunxoxoaruforarshiSu_Somerholiclabiinder1714pasbarunstar1315Mizhi_Janki_Shyamukittyshanthipriyanm21yongshinp Girl_TheJoker--Deepali--LetItGo-nikita_88khushixHeavenlyBliss.Invoker

JennyPenny IF-Addictz

Joined: 03 July 2005
Posts: 90665

Posted: 03 June 2012 at 11:35pm | IP Logged
No reason for this to be SaRun 100th moments/ pics. I guess the reason it's included is because it's very simple like SaRun. SPA brings back so many memories and this pic remains one of my favorites. As much as I love this pic, there are MORE pics of SaRun that I adore and that's the reason this remains on the 100th spot.

It's so beautiful and makes you realize that when two actors click, they click!

The following 128 member(s) liked the above post:

rempyLuvlin28arshiiiNiidhiimandymeggyprathisthahelenMburberry07specailgirlipkknd159andy_sydneyAanchal_Sahunalifathimaa98chatritssj07bigtimeARSHIfanJordinakshu0308labiinder1714cinipaul101MissPunjabiShyamukitty_Janki_Mizhistar1315aruforarshibarunxoxoPreety_womanheahmadSu_Somerholicpasbarunswetha811blackdice1001anjusr06-evan-pollypollynm21shanthipriyaTangledyongshin..Anannya..livyLumosMaximaBarunkidewanifaree..Damsel..Nightingale...memories_immomentsofme.reyaa.archie_79-sayeed-ClaraOswald.nav_bat-Atiya-S.Stephytara_211SunriseGreenaycma98LooneyLunajen_xipkkndfanforevasimran04KatelynxMidnightStarxshona.nishi_I-fianzooni.blueKaranShilpa:)-Garima-mysterieuxmoodie.foodieBarishkiduaa--sumana13--Sidda8Jyo.abracadabraCDloveShiningStar18coolgal270.Sam.-Saumya-jessicad.lostinthought.LivingInPajamasJUHI.HI.Mandy.shockalotpatakhaguddiARJRANSIDVARSKpinky_blueskiesyulZdangerouzIshk.-Aliya-mahamluvsbs.Saraa.sarunholic_arhiuswahshootingstar.xxRiyaDutta...Pwincess....Jazz.-ScarletRose-HSFALyssaPieMephistoTish_Aniincandescentsnoopy84Riima_AzraaSrilathalollaMamiaRehmansilvia1999Simplypriceless_TheJoker-Roshini1494.ayesha.riyya6mishti_17-LetItGo-.JustaDreamSunshine Girlkhushixnikita_88HeavenlyBliss.serendipity.

JennyPenny IF-Addictz

Joined: 03 July 2005
Posts: 90665

Posted: 03 June 2012 at 11:41pm | IP Logged
#99 ( ArHi) : This scene, is on 99th , because it takes their relationship on a higher level. While Arnav has been her savior on many moments/episodes, this one is just a beautiful sequence. The way he senses her being in danger, him running ( I love when BS runs), and the music and chanting. Her almost falling them and him rushing to catch her hands - totally changing their relationship since few days ago, he was the one that made her fall from his office. The scene is so beautiful, from the Arnav telling her to try walking without him for few steps - which was quite symbolic to him leading to finally breaking her fast. One of my most favorite scenes and watched scenes too!

The following 116 member(s) liked the above post:

NiidhiihelenMprathistharempyipkknd159Vini95NadeeanuAanchal_andy_sydneymkhanaspecailgirlfathimaa98SahunaliJordinbigtimeARSHIfanaruforarshiinder1714akshu0308labiSu_SomerholicbarunxoxoPreety_womanstar1315Mizhi_Janki_Shyamukittynm21pollypollyxoxo_BaruNiallanjusr06blackdice1001swetha811shanthipriyalivy..Anannya..-evan-aycma98LumosMaximafareeClaraOswald.-Atiya-nav_batfly_dog..Damsel..LooneyLuna-Medha-ipkkndfanforevajen_x.BumbleBee.simran04soni28tara_211SunriseGreen-sayeed-S.Stephymomentsofme.reyaa.Alyaa_27Jyo.--sumana13--Sidda8coolgal270KaranShilpa:)-Garima-nishi_I-fianzooni.blueBarishkiduaashona.mysterieuxmoodie.foodieKatelynxMidnightStarx-Saumya-.Sam.abracadabraJUHI.HIjessicad.Mandy.shockalotyulZpinky_blueskiesdangerouzIshk.patakhaguddiARJRANSIDVARSKfizii_gurl-Aliya-.Saraa.HSFAsarunholic_arhiuswahshootingstar.xxRiyaDutta...Pwincess...LyssaPiesilvia1999-ScarletRose-.Jazz.MephistoTish_Aniincandescentsnoopy84SrilathalollaMamiaRehmanSimplypricelessriyya6-Deepali-Roshini1494mishti_17.JustaDreamSunshine Girlnikita_88-LetItGo-khushixHeavenlyBliss.serendipity.Invoker

JennyPenny IF-Addictz

Joined: 03 July 2005
Posts: 90665

Posted: 03 June 2012 at 11:46pm | IP Logged
99( SaRun) winning the best jodi and international jodi; ahh the screams, the excitement  entire thing puts it on the 99th spot. You can't describe the moment, the affection you feel for these actors playing the roles. While , I loved every moment of SPA /SaRun, this one stands out, because of the team. Love how the team is cheering them on ,and in the next moment, they are on stage thanking those people - Gul, Gorky and Nissar for creating them. SaRun were already stars, but IPK made them superstars!

and this moment was another one, had to include this moment, it stands alone, the reason why IPK works is NOT only because SaRun click, because everyone clicks.

It's true when Sanaya says IPK feels like home because indeed it is a home and picture speak more words than I can ever write

The following 125 member(s) liked the above post:

rempyprathisthaNiidhiihelenMipkknd159specailgirlVini95morninglory06malli57Aanchal_babyandmemandymeggyfathimaa98Sahunalidarkangelpconfusion2sj07bigtimeARSHIfanJordinlabiakshu0308cinipaul101aruforarshiinder1714Preety_womanbarunxoxoSu_SomerholicMizhiShyamukittyMissPunjabi_Janki_star1315pollypollyyongshinTanglednm21dreamymaya-daffodils-swetha811blackdice1001MaddyAddylivy..Anannya..-evan-shanthipriyaClaraOswald.nav_bat-Atiya-..Damsel..aycma98Nightingale...fareeBarunkidewanijen_xipkkndfanforeva-Medha-LooneyLunasimran04tara_211SunriseGreen-sayeed-memories_immomentsofme.reyaa.S.StephyAmiiishmoodie.foodiemysterieuxBarishkiduaa--sumana13--Sidda8Jyo.coolgal270KaranShilpa:)-Garima-zooni.blueKatelynxMidnightStarx.lostinthought.JUHI.HI.Sam.abracadabra.Mandy.shockalotscarletteblueyulZpinky_blueskiesdangerouzIshk.patakhaguddiARJRANSIDVARSKfizii_gurl-Cheeni--Aliya-mahamluvsbs.Saraa.RiyaDuttasarunholic_arhiuswahshootingstar.xx-ScarletRose-HSFA.Jazz.incandescentTish_AniMephistoLyssaPiesilvia1999snoopy84Riima_AzraaSrilathalollaMamiaRehmanSimplypriceless-Deepali-Roshini1494riyya6mishti_17Sunshine Girl.JustaDream-LetItGo-nikita_88khushixHeavenlyBliss.serendipity.Invoker..Prinzy..

Tish_Ani IF-Sizzlerz

Joined: 22 October 2011
Posts: 12930

Posted: 03 June 2012 at 11:48pm | IP Logged hert stopped beating
d 1st promo of ipkknd ws soo gud...awee..."ho gaya satyanaash!!" luvd dat dialogue of our kkg, n den asr cums n givs money...wahwah!!
thanku for dis luvly post...even i luv deir spa moments...i think nobody else hv such a strong friendship eva as ipkknd team...cheers!!Clap

Edited by Tiashaa - 03 June 2012 at 11:50pm

The following 9 member(s) liked the above post:


JennyPenny IF-Addictz

Joined: 03 July 2005
Posts: 90665

Posted: 03 June 2012 at 11:50pm | IP Logged
99 scene of IPK: Payal - Akash meet at the mandir and why I chose this scene? Hmm, Payash has had few scenes here and there, but this one is beautiful because of the way Akash is looking at her while Payal feels a tinge of something for him as well. The way she returns the thaal and the way Anjali realizes something is up is very sweet. 

I think dogra and Deepali looked quite nice here and IPK as a whole is about these characters, plus I can't think of any other Payal-Akash scene I found worth watching ( May GH and Gul can give them SOME BETTER SCENES)

The following 83 member(s) liked the above post:

prathisthababyandmespecailgirlipkknd159Aanchal_fathimaa98JordinlabiSu_SomerholicPreety_womanArshiluvu27star1315Mizhipollypollyyongshinnm21blackdice1001swetha811..Anannya..livyNightingale...Barunkidewanifareeaycma98..Damsel..fly_dog-Atiya-nav_batLooneyLuna-Medha-ipkkndfanforevatara_211SunriseGreenreyaa.S.StephyJyo.Sidda8zooni.bluemoodie.foodiemysterieuxBarishkiduaaKatelynxMidnightStarxabracadabra.Sam..lostinthought.jessicad.Mandy.shockalot.Saraa.fizii_gurl-Aliya-patakhaguddipinky_blueskiesyulZARJRANSIDVARSKdangerouzIshk.RiyaDuttaHSFAuswahshootingstar.xxcocoatreeLyssaPiesilvia1999Mephistoincandescent.Jazz.-ScarletRose-snoopy84SrilathalollaMamiaRehmanRoshini1494Simplypricelessriyya6mishti_17-Deepali-Sunshine Girl-LetItGo-nikita_88khushixHeavenlyBliss...Prinzy..Invoker

JennyPenny IF-Addictz

Joined: 03 July 2005
Posts: 90665

Posted: 04 June 2012 at 12:06am | IP Logged
ArHi( 98): Arnav breaks La's fast , leading to small J moment for Khushi. Loved this scene and when it came on, I was super happy. The way the actors emoted. It also showed for a bit that Khushi was quite uncomfortable with the fact that Arnav broke La's fast. and in that whole process, she couldn't even light the damn match boxLOL and Arnav expressions were bang on. A part of him was happy that she felt pain and uncomfortable and another part of him, the ASR was maha confused. He was confused with his impending feelings for her, why the heck does she affect me so much was going through his mind and it just stands out for ME.

The following 105 member(s) liked the above post:

prathisthaNiidhiihelenMhpmagicalbabyandmespecailgirlVini95ipkknd159rabbaveeverydayAanchal_fathimaa98bigtimeARSHIfanJordinakshu0308labisarasahejaaruforarshiSu_SomerholicPreety_womandedeepyalovestar1315MizhiShyamukittyyongshin-DramaBeans-nm21pollypollyblackdice1001swetha811-daffodils-..Anannya..livyshanthipriya-Atiya-nav_batfly_dog..Damsel..Nightingale...Barunkidewanifareeaycma98Malvika18ipkkndfanforevaLooneyLunasimran04tara_211SunriseGreenmemories_immomentsofme.reyaa.S.StephyJyo.--sumana13--Sidda8-SilverFlames-zooni.bluecoolgal270-Garima-mysterieuxmoodie.foodieBarishkiduaaKatelynxMidnightStarxJUHI.HI.lostinthought.jessicad.Sam.-Saumya-.Mandy.pinky_blueskiesyulZfizii_gurl-Aliya-.Saraa.dangerouzIshk.patakhaguddiARJRANSIDVARSKbookluveruswahshootingstar.xxRiyaDuttaHSFAMephisto-ScarletRose-.Jazz.cocoatreeLyssaPiesilvia1999snoopy84Riima_AzraaMamiaRehmanSimplypriceless-Deepali-Roshini1494riyya6mishti_17.JustaDreamSunshine Girl-LetItGo-khushixnikita_88HeavenlyBliss.serendipity...Prinzy..Invoker

Go to top

Related Topics

  Topics Author Replies Views Last Post
OS: Shikdum Romance

2 3 4 5 6 7 8 9

Author: CrazyChatterbox   Replies: 70   Views: 36364

CrazyChatterbox 70 36364 12 October 2013 at 2:23pm by priyanka1998
If you love Sarun comment!!!

2 3 4 5 6 7 ... 30 31

Author: Ipkknd-ki-fan1   Replies: 242   Views: 25577

Ipkknd-ki-fan1 242 25577 01 August 2013 at 4:02am by misscrazyfan
New SaRun Pictures added

2 3 4 5 6 7 ... 25 26

Author: alishba45   Replies: 201   Views: 52271

alishba45 201 52271 26 May 2013 at 9:36pm by cool_zephyr
ArHi Pixx Form New Arhi Engegament Promo

2 3 4 5 6 7 8

Author: MaNanHoLiC   Replies: 57   Views: 21040

MaNanHoLiC 57 21040 08 November 2011 at 9:53am by --Siva--
news:ArHi Ka ArHi-Sizzling


Author: Khilonaa   Replies: 15   Views: 10339

Khilonaa 15 10339 20 October 2011 at 6:55am by Khilonaa

Forum Quick Jump

Forum Category / Channels

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index