Balika Vadhu
Balika Vadhu
Balika Vadhu



BV - May 15th 2012 - Written Update - Complete

iloveidiotbox Goldie

Joined: 24 October 2005
Posts: 1674

Posted: 15 May 2012 at 8:28am | IP Logged
Rajasthan CM presents award to Anandi for all her achievements. They request Anandi to say a few words. Anandi recites some poem she learnt in school as a kid. The poem describes a girl's dreams and how the dreams are broken. She says this poem depicts the evils of bal-vivah. This is what has inspired to come forward in life. She declares that all Jetsarians deserve the award along with her. She thanks all the people who have helped her in her endeavors. She thanks her teacherji, DS, Sumitra, Bhairav and all others. Anandi says she will strive to abolish Bal vivah as much as she can and also to educate all girls. She also vows to make Jetsar an example to the rest of the country. Everyone is happy and applaud.

CM then announces that he has appointed a collector for Jetsar who will help in Jetsar's development and progress. He calls out Shivraj Shekhar, the new collector of Jetsar. Everyone turns around to see who it is. Anandi is shocked to see her savior walk toward the stage flanked by security guards. DS too realises Shivraj saved Anandi. DS tells Bhairav and Basanth that Shivraj saved Anandi. 

Shivraj says that first time in his career he has been posted to a place, which went from village to jilla in a matter of minutes. He hopes to have the villager's support and says that with a sarpanch like Anandi, there is no need for him. DS tells Bhairav that she thought the collector would be a khoosat, but he is in fact a jawaan-baaka chora LOL, who is so handsome. Bhairav chides her and tells her he knows what she is thinking. but its possible Shivu is married. DS wonders who is the lucky girl is who is married to Shivu. Shivu tells everyone they can approach him anytime. Everyone applaud. 

They announce Anandi's school girls' programme next. The girls dance. Anandi and Shivu glance at each other and smile. 

Shivu playing the dhol while Anandi dances with her girls. Everyone looks on happily. DS looks at the two is very happy


Edited by iloveidiotbox - 16 May 2012 at 8:06am

The following 127 member(s) liked the above post:

*Shruti*mvatsamomsx3ahcirrohini_2007shobs30xbakulaindy1979webkapsobha229shivnirnashili04rani_mradhiisgujaratigirlniki_pnpragyakumarAMSTswarajgirloveremixsharmilaprasadeshachrachnadhodi713sujata2000sanika1507guninoorAnku_20vrsolaSravsk7skapu80arundhati64ria0123naniilyouSwethaVishnuLOLENmilumeereema.ypraneetha777radozvanSadiePNaksh4evaaSinSinWebsiechulbuli7ojas143divyababumitumishabana_79praman1234RosieChimani88gigusersusan88~~~Sweta~~~asiaheartlrl fannandrjpdolly_07nanda_gopaviraf4uSun-LovepuniragHeenapekomaspps_ppsone2nonekripsyGoDsLoVebmm1985nithi07lakshmikrasyadadamitturajursshreetijarasparksflyjaneniroopaearth1978sbadamvishwa19cherry_ikrunesbrick_redjagspaddytimepass-GrilledCheese-Chytraandvvrinda9183mrin0709cherieLoverteri_susanPicasso9naj7Paramjit_Nancy_gawkerAbhiAnidhrashtee..Naina..bumtrinketcimbaTwinkie_Starnya_ansarinikhilageetsweetysaransamvi.swetha_chILoveDramaswethasyam08edwardcullen19monamie111ash91fuzzyfaceshivani003anna44prava55663ThanuAditya-lazybee-tamanna1391--Udhay--pyar-ishkkhusi_*tiny15-Swetha-Sano88

--Udhay-- IF-Stunnerz

Joined: 22 October 2011
Posts: 33780

Posted: 15 May 2012 at 8:38am | IP Logged
Thanks for the express fast update!! Today's episode was fantabulous!! Anandi's speech was nice and touching.. Entry of New collector - Shivraj after announcement by CM was grand and Majestic.. The BG and grandeur of the sequence made Shivraj look like a young prince!! Dadisa was super-excited like a young kid when she saw that saviour of Anandi was actually the new collector!! Listening to Collector's speech, it looks like he is well aware of Anandi's hardwork and goodness, he is impressed with her to an extent!! His speech was short and crisp, well done!! Kids danced beautifully and the episode ended with beautiful smiles of ShivAn!! OMG what a fabulous precap guys!! Both r looking gorgeous!!

Edited by Udhay - 15 May 2012 at 9:10am

The following 11 member(s) liked the above post:


vishwa19 Senior Member

Joined: 27 December 2011
Posts: 383

Posted: 15 May 2012 at 8:58am | IP Logged

The following 1 member(s) liked the above post:


Suchi- IF-Sizzlerz

Joined: 19 November 2009
Posts: 12596

Posted: 15 May 2012 at 9:05am | IP Logged
Uday there is a reason why the updates update. If you wish to update you should contact the team and volunteer instead of writing update in a thread like this. It's not fair and nice

The following 5 member(s) liked the above post:


blushing IF-Stunnerz

Joined: 02 March 2010
Posts: 43157

Posted: 15 May 2012 at 9:06am | IP Logged
Thanks ...Clap

Can't wait for tomorrow episode after watching PRECAP Embarrassed Embarrassed

The following 1 member(s) liked the above post:


khusi_* IF-Stunnerz

Joined: 24 January 2005
Posts: 26047

Posted: 15 May 2012 at 9:09am | IP Logged
ohh take ur time priya...

Chhoti anandi and badi anandi's poem..she was helpless and now a confident sarpanch..time has changed..Approve

I remember I was mad at ds at the time of chhoti anandi but ds too changedLOL

the way ds reacted after seeing collector..just hilarious and instantly started match making…and bhiron got is good that she didn't imagine him in any attitre ..that would have very strange. LOL

Again a perfect entry..and his speech was short and simple…! Good. And anandi her speech was nice the way she mentioned every teacher in her life…

Both smile at each other…that's very cute.

And precap….aayore maaro dholna,,,really anandi!!Wink Yeah near u with dhol!

shiv-anandi looked perfect….and ds is la la land..Day Dreaming

Edited by khusi_* - 15 May 2012 at 9:24am

The following 9 member(s) liked the above post:


--Udhay-- IF-Stunnerz

Joined: 22 October 2011
Posts: 33780

Posted: 15 May 2012 at 9:11am | IP Logged
@Suchi: Mistake rectified.. My post edited.. Sorry..

The following 2 member(s) liked the above post:


priyush Groupbie

Joined: 20 April 2012
Posts: 118

Posted: 15 May 2012 at 9:12am | IP Logged
he was awesome today by yesterday episod only v known that he was gentle helping n wont show pride as he was a collector like that if he want to show he can show before all n a cute precap i can dream marriage celebration Clap hungama! i want anandi to have a happy life thought siddarth is not so cute as shashank but he suits in dat character well all d best siddarth show miracle wth ur act!Smile nooo jaaan re unionAngry

The following 1 member(s) liked the above post:


Go to top

Related Topics

  Topics Author Replies Views Last Post
BV 5th December 2011 - Written Update - COMPLETE

Author: Artemisia   Replies: 7   Views: 5137

Artemisia 7 5137 05 December 2011 at 11:01pm by swetha_ch
BV 2nd December 2011 - Written Update - COMPLETE


Author: Artemisia   Replies: 12   Views: 5098

Artemisia 12 5098 05 December 2011 at 7:52am by flamenco
BV 28th November 2011 - Written Update- COMPLETE


Author: Artemisia   Replies: 14   Views: 5533

Artemisia 14 5533 29 November 2011 at 4:24am by Missesha
BV 25th November 2011 - Written Update - COMPLETE


Author: Artemisia   Replies: 12   Views: 5314

Artemisia 12 5314 28 November 2011 at 3:32am by ....Anchal....
BV 21st November 2011 - Written Update - COMPLETE


Author: Artemisia   Replies: 12   Views: 5948

Artemisia 12 5948 22 November 2011 at 8:28am by neelabha

Forum Quick Jump

Forum Category / Channels

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index