Channel V Dil Dosti Dance

India-Forums

   
Channel V Dil Dosti Dance
Channel V Dil Dosti Dance

KriYaansh/ArSha SI # 6:Phir Mohabat Karne Chala Hai Tu (Page 100)

MAYURFAN001 IF-Rockerz
MAYURFAN001
MAYURFAN001

Joined: 03 July 2009
Posts: 5196

Posted: 22 September 2011 at 9:50pm | IP Logged
Originally posted by kumjoo

One other thing that I didn't like in today's epi was ,

 How could those Bhade ka tatttus...say JAMES BOND KA AULAD to Reyaansh Singhania?? 

At one point that looser said DEKH BETA to REY...I was likeD'oh
 
 
 I just HATED this scene.. and the dialogues were just uncalled for!.. Its like REY ki kuch Value hi nahi rakhi yaar show mein.. This is Heights.. First.. CVS create the Super cool, no one can touch me types image for REY.. and then they also write such scripts.. bechara REY.. and bechara AMAR.. You can see how HARD he is trying .. Its like.. script writers are just Lazily writing scipts for Rey and Kria! and Kriyansh!
 
These DIALOGUES were ABsolutley not needed in my oppinion!.. I think It cld have been better... and those guys.. what Horrible acting!!. Their dialogues dliveries also sucked man!!..
 
This totally messed it up for me 
 
 
 
 

The following 4 member(s) liked the above post:

r07c100littledevilsBakho.RKkriyanshfan

kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 22 September 2011 at 9:51pm | IP Logged
HOLY CRAP!! What is that?? REY has Bandage in his hand in that Dance sequence...URRGHHHGHGHGHGHGHG!! I am so Pissed off...

Can anybody believe that CVz have been making shows for more than a decade now?? They are so bloody Un-Professional...They don't have any standards in making a show...They really need some focused people in the Creatives team...

Creatives of D3 NEED SOME LIFE. THEY ARE PATHETIC

The following 4 member(s) liked the above post:

r07c100littledevilskriyanshfansweetshine

MAYURFAN001 IF-Rockerz
MAYURFAN001
MAYURFAN001

Joined: 03 July 2009
Posts: 5196

Posted: 22 September 2011 at 9:54pm | IP Logged
AND did you watch that Rajnikanth Jacket Move!!
 
I was like.. Silly... Then I was ROFL.. 
 
What was that!!!! R for REY...se seedhe R for RAJNI DUDE ... Oh Boy!!.. was laughing my head off.. That combined with the MATRIX PUNCH!!.. HAHAHAHAHAHAH...
 
 
I was expecting a very INTENSE fight  scene.. and I ended up getting an INTENSE comical fight scene!..
 
BUT.. I must say.. AMAR held on to his part.. so it was watchable.. otherwise.. Dead
 
 

The following 5 member(s) liked the above post:

r07c100littledevilsBakho.RKkriyanshfansweetshine

kriyanshfan IF-Rockerz
kriyanshfan
kriyanshfan

Joined: 04 September 2011
Posts: 6233

Posted: 22 September 2011 at 9:58pm | IP Logged
One of the dialogues was really gud of the gundas.
 
"kal canteen mein kyun chup baitha tha"
 
 
 

The following 2 member(s) liked the above post:

r07csweetshine

kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 22 September 2011 at 9:58pm | IP Logged
I am Having Headache Guys!! I so wanna SCREAM at the top of my voice...

This is so not done. How can they be so unprofessional???? 

Kuch Standard hai bhi ki nahi yeh CVz ki?? 

I am so loosing Interest ...Only for ArSha I am hanging in to this BLOODY LAME Show..else I would have called off long back ...man!! this is a mental torture ...

The following 1 member(s) liked the above post:

kriyanshfan

StinsonIsHere IF-Sizzlerz
StinsonIsHere
StinsonIsHere

Joined: 11 May 2009
Posts: 23104

Posted: 22 September 2011 at 9:59pm | IP Logged
Meera bhi aa gyi
hadd h ab mai kaise jaungi

The following 1 member(s) liked the above post:

kriyanshfan

MAYURFAN001 IF-Rockerz
MAYURFAN001
MAYURFAN001

Joined: 03 July 2009
Posts: 5196

Posted: 22 September 2011 at 10:00pm | IP Logged
KJ!!
 
 
PALKI  said in one ofher IF interviews that she has been doing this for 15 years!!!! WHAT has she learned in 15 years??? NOTHING!!!!Shocked
 
Same old bloopers.. Same old script errors.. Its like..they just want to Throw something together and AIR IT.. Its like they LACK passion. and they only do it as a JOB!!!! When you are a story teller.. how can you MESS up your story!!. How can you NOT pay attention to the scripts
 
How can you not know what script you wrote for the character a few months ago?
 
..SHOCKING!

The following 1 member(s) liked the above post:

r07c

kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 22 September 2011 at 10:00pm | IP Logged
Originally posted by kriyanshfan

One of the dialogues was really gud of the gundas.
 
"kal canteen mein kyun chup baitha tha"
 
 
 

BY GOD ..IF I was there ...main  uss GUNDAS ko toh HAATH se PER SE...DE Dana Dan marti...LOOSERS...

Go to top

Forum Quick Jump

Forum Category / Channels
Forums

Channel V Dil Dosti Dance Topic Index

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index