Channel V Dil Dosti Dance

India-Forums

   
Channel V Dil Dosti Dance
Channel V Dil Dosti Dance

KriYaansh/ArSha SI # 5:Mere Pass Hai Tu Mere Saath Hai (Page 65)

100littledevils IF-Dazzler
100littledevils
100littledevils

Joined: 13 April 2011
Posts: 4308

Posted: 20 September 2011 at 10:57pm | IP Logged
chalo guys me going...*cries* ..yeh gum nai hain ki iam goignt o score gud marks in internal... but yeh gum hain ki i have to leave this hawt convo...haahahah Cry

The following 1 member(s) liked the above post:

sweetshine

kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 20 September 2011 at 10:58pm | IP Logged
Originally posted by kriyanshfan

Originally posted by kumjoo

Did I already mention, last weekend I was watching SWARON sequence fro mRDX party, and I was SHOCKED to see the intimate scenes between them. 

If, I get to see something like that by KRIYAANSH...I don't think I will be ALIVE to be SHOCKED...
 
 
whn u mentioned i had to go back and c it
when the epi was aired i didnt gv it much tht
i was more interested in watchg kriyaaansh
 
but wow kitna kuch kar diya swaron ne
slpg next to each other
kabhi sharon upar
toh kabhi swayum
kiss on shoulders, neck, cheeks !!!!!!
ye kriyaansh ke saath nahi dikha sakte cvs Angry
 


HA HA HA HAHA!!! ..Man! Can't stop laughing on that...That sounds ...ha ha hah!! can't even say it here...Shruti meri Chutti kar degi IForum se...

The following 3 member(s) liked the above post:

100littledevilskriyanshfansweetshine

StinsonIsHere IF-Sizzlerz
StinsonIsHere
StinsonIsHere

Joined: 11 May 2009
Posts: 23110

Posted: 20 September 2011 at 10:58pm | IP Logged
Ok w8 guys lemme switch on my laPpy
kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 20 September 2011 at 10:58pm | IP Logged
Originally posted by 100littledevils

chalo guys me going...*cries* ..yeh gum nai hain ki iam goignt o score gud marks in internal... but yeh gum hain ki i have to leave this hawt convo...haahahah Cry

All the best PIYU...BE Good in internals..Don't think about Editing another ArSha Pic..Lolz...and we will catch u after the episode...

The following 2 member(s) liked the above post:

100littledevilsStinsonIsHere

kriyanshfan IF-Rockerz
kriyanshfan
kriyanshfan

Joined: 04 September 2011
Posts: 6233

Posted: 20 September 2011 at 10:59pm | IP Logged
Originally posted by kumjoo

Originally posted by kajen

I Have a feeling that time they have introduces this track to clear out the misunderstandings
like kria might say that
kisi ne mere sath misbehave kiya wo aap dekh nhi paye
par jab pure college k samne aapne meri insult ki thi uska kya


i hope this happens

Oh Aarti...If this happens..MY GOD!! wait lemme think ...my brain is not working..LOLzz
 
 
 
chane ke zhaad pe mat chaddho
hum bolke jinx na kar de
hum jo bhi bolte hai ulta ho jata hai
kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 20 September 2011 at 11:01pm | IP Logged
Originally posted by MAYURFAN001

FOR ALL who want to listen to the extended version that I cld find.. Check this Kriyaansh scene and listen from 9:11 onwards to the end..
that tune is sooo freaking HOT when I imagine Kriyaansh dancing to it.. I am pretty sure they already have the whole SONG ready.. but they will play the whole tune for the SPECIAL moment


That's freaking Awesome...I think the more Extended version was played in Wash Room Sequence in RDX party...lemme see If I can find the link...
MAYURFAN001 IF-Rockerz
MAYURFAN001
MAYURFAN001

Joined: 03 July 2009
Posts: 5196

Posted: 20 September 2011 at 11:01pm | IP Logged
KJ and PIYU... I LOVE BOTH WHITE and BLACK...
 
 
I will go for BLACK because we have seen them wear white too often..
 
 I can Imagine Kria wearing a LONG Flowy type of a dress.. Something similar to what she wore in Khuda Jaane.. ...backless... but the length of the dress needs to be longer and extremely flowy... Straight HAIR..(AND NO HEELS.. I am going to BURN her heels if she wears them lols)
 
AND AMAR--- DITTO how KJ described it..
 
WOW WOW WOW!.. I cannot stop imagining their dance on ohhh hoo hoo.. with full on Breeze blowing.. and I want the lighting to be DIM.. not bright..With a beautoful SET as the backdrop!
 
DARN PALKI!!!!! KUCH AISA HI KARO!!

The following 4 member(s) liked the above post:

100littledevilskumjookriyanshfansweetshine

kriyanshfan IF-Rockerz
kriyanshfan
kriyanshfan

Joined: 04 September 2011
Posts: 6233

Posted: 20 September 2011 at 11:02pm | IP Logged
Originally posted by kumjoo

Originally posted by kriyanshfan

Originally posted by kumjoo

Did I already mention, last weekend I was watching SWARON sequence fro mRDX party, and I was SHOCKED to see the intimate scenes between them. 

If, I get to see something like that by KRIYAANSH...I don't think I will be ALIVE to be SHOCKED...
 
 
whn u mentioned i had to go back and c it
when the epi was aired i didnt gv it much tht
i was more interested in watchg kriyaaansh
 
but wow kitna kuch kar diya swaron ne
slpg next to each other
kabhi sharon upar
toh kabhi swayum
kiss on shoulders, neck, cheeks !!!!!!
ye kriyaansh ke saath nahi dikha sakte cvs Angry
 
 

HA HA HA HAHA!!! ..Man! Can't stop laughing on that...That sounds ...ha ha hah!! can't even say it here...Shruti meri Chutti kar degi IForum se...
 
 
 
ROFL one track mind hain yahaan sabka !!!

Go to top

Forum Quick Jump

Forum Category / Channels
Forums

Channel V Dil Dosti Dance Topic Index

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index