Channel V Dil Dosti Dance

India-Forums

   
Channel V Dil Dosti Dance
Channel V Dil Dosti Dance

KriYaansh/ArSha SI # 5:Mere Pass Hai Tu Mere Saath Hai (Page 64)

kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 20 September 2011 at 10:49pm | IP Logged
Originally posted by kajen

Aarre i forgot to rite fight meera
it was
kya rey aur kria ki fight le ayegi unhe kareeb

I really don't trust this Voice over people ..LOLz...

Chane ke Jhaad par ..hum saab ko they throw from there for nothing..IDIOTS!!

The following 3 member(s) liked the above post:

100littledevilskriyanshfansweetshine

100littledevils IF-Dazzler
100littledevils
100littledevils

Joined: 13 April 2011
Posts: 4308

Posted: 20 September 2011 at 10:50pm | IP Logged
Originally posted by MAYURFAN001

Originally posted by kumjoo

Originally posted by 100littledevils

OMG THEY ARE SOO CLOSE!!! Blushing



Damn!! Amar is almost Kissing Shakti...Now, I am thinking ...They were together for so many performances in DID2, They must have rehearsed for hours and hours and days to days for each performance...Kabhi Accidentally Kiss kiya hoga ArSha ne..What do you guys think?? Shit yaar...yeh! ArSha peecha nahi chodte mere Dimag ka..Day Dreaming

Yeh ALMOST KISS kabhi ACCIDENTAL KISS hua hoga ki nahi??
 
LOLS KJ!!. OH boy.. Some of their rehearsal videos are soo crazy.. There are videos where Shakti is like clmbing all over him.. he is like doing KUSTI with her.. Lolz.. I think it was a limelight video..hehehehe
 
DANG.. They have done it all!!! TODAY.. They are MAHA COMFY with each other.. Thats all I care about.. so you know... When PALKI uses her ROMANTIC CREATIVE BRAINS... ARSHA cannot refuse... and they are sooo comfortable.. I dont think they shld mind doing any and ALL Scenes LOLZ (Thats my EVIL brain speaking)Evil Smile


u know what i have seen that video like more than 100 times..hahahaha...damn yaar they are soo comfortable with each other... iam sure we r getting armaan riddhima type romance...







The following 2 member(s) liked the above post:

sweetshineStinsonIsHere

kriyanshfan IF-Rockerz
kriyanshfan
kriyanshfan

Joined: 04 September 2011
Posts: 6233

Posted: 20 September 2011 at 10:51pm | IP Logged
Originally posted by kumjoo

Did I already mention, last weekend I was watching SWARON sequence fro mRDX party, and I was SHOCKED to see the intimate scenes between them. 

If, I get to see something like that by KRIYAANSH...I don't think I will be ALIVE to be SHOCKED...
 
 
whn u mentioned i had to go back and c it
when the epi was aired i didnt gv it much tht
i was more interested in watchg kriyaaansh
 
but wow kitna kuch kar diya swaron ne
slpg next to each other
kabhi sharon upar
toh kabhi swayum
kiss on shoulders, neck, cheeks !!!!!!
ye kriyaansh ke saath nahi dikha sakte cvs Angry
 

The following 2 member(s) liked the above post:

100littledevilskumjoo

MAYURFAN001 IF-Rockerz
MAYURFAN001
MAYURFAN001

Joined: 03 July 2009
Posts: 5196

Posted: 20 September 2011 at 10:52pm | IP Logged
FOR ALL who want to listen to the extended version that I cld find.. Check this Kriyaansh scene and listen from 9:11 onwards to the end..
that tune is sooo freaking HOT when I imagine Kriyaansh dancing to it.. I am pretty sure they already have the whole SONG ready.. but they will play the whole tune for the SPECIAL moment

The following 3 member(s) liked the above post:

100littledevilskriyanshfansweetshine

StinsonIsHere IF-Sizzlerz
StinsonIsHere
StinsonIsHere

Joined: 11 May 2009
Posts: 22735

Posted: 20 September 2011 at 10:53pm | IP Logged
I Have a feeling that time they have introduced this track to clear out the misunderstandings
like kria might say that
kisi ne mere sath misbehave kiya wo aap dekh nhi paye
par jab pure college k samne aapne meri insult ki thi uska kya


i hope this happens

Edited by kajen - 20 September 2011 at 10:55pm

The following 2 member(s) liked the above post:

100littledevilskriyanshfan

kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 20 September 2011 at 10:53pm | IP Logged
Originally posted by MAYURFAN001

Originally posted by kumjoo

Originally posted by 100littledevils

OMG THEY ARE SOO CLOSE!!! Blushing



Damn!! Amar is almost Kissing Shakti...Now, I am thinking ...They were together for so many performances in DID2, They must have rehearsed for hours and hours and days to days for each performance...Kabhi Accidentally Kiss kiya hoga ArSha ne..What do you guys think?? Shit yaar...yeh! ArSha peecha nahi chodte mere Dimag ka..Day Dreaming

Yeh ALMOST KISS kabhi ACCIDENTAL KISS hua hoga ki nahi??
 
LOLS KJ!!. OH boy.. Some of their rehearsal videos are soo crazy.. There are videos where Shakti is like clmbing all over him.. he is like doing KUSTI with her.. Lolz.. I think it was a limelight video..hehehehe
 
DANG.. They have done it all!!! TODAY.. They are MAHA COMFY with each other.. Thats all I care about.. so you know... When PALKI uses her ROMANTIC CREATIVE BRAINS... ARSHA cannot refuse... and they are sooo comfortable.. I dont think they shld mind doing any and ALL Scenes LOLZ (Thats my EVIL brain speaking)Evil Smile

IDK, it's my personal opinion...But, I feel like they have become more uncomfortable with each other these days, IDK for what reason. But, may be giving lot of retakes they have become uncomfy in some way...Don't have no idea..what I talking ..I am just blabbering...

But, I wish ..they never feel that dis-comfort between and as you said ..they don't deny PALKI for anything at all...LOlz

The following 1 member(s) liked the above post:

100littledevils

kriyanshfan IF-Rockerz
kriyanshfan
kriyanshfan

Joined: 04 September 2011
Posts: 6233

Posted: 20 September 2011 at 10:54pm | IP Logged
Originally posted by kumjoo

Originally posted by kajen

Aarre i forgot to rite fight meera
it was
kya rey aur kria ki fight le ayegi unhe kareeb

I really don't trust this Voice over people ..LOLz...

Chane ke Jhaad par ..hum saab ko they throw from there for nothing..IDIOTS!!
 
 
rite
yeh taglines hamesha confuse karti hain
election ke waqt nahi
what was the tagline
i thk smthg  like kria and rey hain is baar ek doosre ke saame
kaun jitega blah blah blah
finally what did they show
sharon and swayum fighting
end mein sirf rey ne ek thappad khaya

The following 2 member(s) liked the above post:

100littledevilssweetshine

kumjoo IF-Rockerz
kumjoo
kumjoo

Joined: 21 July 2011
Posts: 8707

Posted: 20 September 2011 at 10:54pm | IP Logged
Originally posted by kajen

I Have a feeling that time they have introduces this track to clear out the misunderstandings
like kria might say that
kisi ne mere sath misbehave kiya wo aap dekh nhi paye
par jab pure college k samne aapne meri insult ki thi uska kya


i hope this happens

Oh Aarti...If this happens..MY GOD!! wait lemme think ...my brain is not working..LOLzz

The following 2 member(s) liked the above post:

100littledevilskriyanshfan

Go to top

Forum Quick Jump

Forum Category / Channels
Forums

Channel V Dil Dosti Dance Topic Index

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index