Geet - Hui Sabse Parayee


Geet - Hui Sabse Parayee
Geet - Hui Sabse Parayee

MSK to his fanz from the sbs segment...

bobby13rocks IF-Stunnerz

Joined: 29 September 2010
Posts: 36045

Posted: 23 May 2011 at 4:11am | IP Logged
Maan despo to become MSK again.Wink.too tired of being Balwant Singh..Confused
Letz find out what he has to say...Wink

Maan-Haiii kab mujhe Balwant Singh se wapas  Maan Sigh Khurana ka position milega..Cry

Maan- mei toh thak gaya gadi dhote dhote aur Geet ki parivar ko khush karte karte ...mujhe KM lautna hai...Confused

Maan- yeh cv's bhi na mujhe muft mei double role kaarwa diye woh bhi single fees mei.Wink.abh bohot ho chuke baas..either give back my position as MSK or I'll charge double.LOL

Now Geet giving Maan some consolation..
Geet- Maan aap chinta maat kijiye ..aapko jald MSK ki position milne wala hai...aap bas humare next action ki baare mei sochiye..Embarrassed
Maan- pehle MSK ki position toh regain karne doh phir uske baad sochenge..Wink

Geet- kahi aap ke baad mei sochne ki chakkar mei hume fhir se tabele mei lantern ki saath SR na mil jaye..LOL
Maan- iss bar agar cv's kuch ayse sequence laate hai toh mei pehle unhe karke dikhane ko bolunga..fhir hum karenge..Embarrassed

Geet-kahi cv's ke dikhane ki chakkar mei hum peeche choot na jaaye .Wink.aur cv's ka hi final take ho jaaye..LOL
Maan-tum chinta maat karo Geet..unke action se pehle hi hum cut bol denge.Wink.jaise woh humare saath kiye thhe..'tit for tat'ROFL

Edited by bobby13rocks - 23 May 2011 at 5:43am

The following 20 member(s) liked the above post:

laila889visheshsSominababahadahsunithavarmaMounchysiroililytazeen_29LadyArwenRishabala.loveEccentric.Being_Rashmiminnie_tweetieLuvScoobymechantefilleanshramaaniqrakhushimuskaanFallen Angelblackb28

_Rashmi IF-Rockerz

Joined: 11 February 2011
Posts: 6254

Posted: 23 May 2011 at 4:29am | IP Logged
n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
luved the captionsBig smile

The following 3 member(s) liked the above post:


bobby13rocks IF-Stunnerz

Joined: 29 September 2010
Posts: 36045

Posted: 23 May 2011 at 4:34am | IP Logged
Originally posted by lovelygeet24x7

n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
luved the captionsBig smile
Rash ..I've updated a bit ..have a look dear..

Thanxx for liking it..Smile

The following 1 member(s) liked the above post:


minnie_tweetie IF-Rockerz

Joined: 23 July 2010
Posts: 8000

Posted: 23 May 2011 at 4:37am | IP Logged
loved ur post...amazing...!!!!!!

The following 1 member(s) liked the above post:


maaniqra IF-Sizzlerz

Joined: 15 November 2009
Posts: 22531

Posted: 23 May 2011 at 4:38am | IP Logged

The following 1 member(s) liked the above post:


_Rashmi IF-Rockerz

Joined: 11 February 2011
Posts: 6254

Posted: 23 May 2011 at 4:38am | IP Logged
Originally posted by bobby13rocks

Originally posted by lovelygeet24x7

n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
luved the captionsBig smile
Rash ..I've updated a bit ..have a look dear..

Thanxx for liking it..Smile
seen.i m likeROFLROFLROFL.luved the last para especially tit 4 tatROFLROFL
 maaneet's 2nd sr in a matEmbarrassedROFL

The following 2 member(s) liked the above post:


bobby13rocks IF-Stunnerz

Joined: 29 September 2010
Posts: 36045

Posted: 23 May 2011 at 4:39am | IP Logged
Originally posted by silkyarora

loved ur post...amazing...!!!!!!
Thanxx dear for ur appreciation..Smile

The following 1 member(s) liked the above post:


bobby13rocks IF-Stunnerz

Joined: 29 September 2010
Posts: 36045

Posted: 23 May 2011 at 4:42am | IP Logged
Originally posted by lovelygeet24x7

Originally posted by bobby13rocks

Originally posted by lovelygeet24x7

n maan also wants 2 go bak 2 his office attire so that he can steal hearts againLOLEmbarrassed
luved the captionsBig smile
Rash ..I've updated a bit ..have a look dear..

Thanxx for liking it..Smile
seen.i m likeROFLROFLROFL.luved the last para especially tit 4 tatROFLROFL
 maaneet's 2nd sr in a matEmbarrassedROFL

Actually they r not not allowing to post any pics ...closing the just to post these pics made these captions hastily...Wink
Hope from haystack they don't land in a mat..LOL

The following 2 member(s) liked the above post:


Go to top

Related Topics

  Topics Author Replies Views Last Post
GEET On SBS Segment

Author: BrOkeN   Replies: 0   Views: 785

BrOkeN 0 785 11 August 2010 at 11:50am by BrOkeN
guyz r v in fr 1 mre mirchi segment..hehe

Author: adits7   Replies: 0   Views: 3484

adits7 0 3484 26 July 2010 at 2:42pm by adits7
Maneet SBS segment PICS... all updated..chk it


Author: bubblygal1711   Replies: 15   Views: 2817

bubblygal1711 15 2817 21 July 2010 at 9:00am by 49erFan
dev's fanz...


Author: Pinam3   Replies: 15   Views: 1019

Pinam3 15 1019 08 July 2010 at 4:10pm by raym1

Forum Quick Jump

Forum Category / Channels

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index