Tere Liye

India-Forums

   
Tere Liye
Tere Liye

||* TL Creations Gallery #4 *Rd pg 37 & 61|| (Page 5)

Soaps1 IF-Stunnerz
Soaps1
Soaps1

Joined: 03 October 2008
Posts: 43629

Posted: 25 January 2011 at 10:38pm | IP Logged
Great work every one

Fizzy simply awesome

The following 1 member(s) liked the above post:

naadanmasakalli

.shona. IF-Sizzlerz
.shona.
.shona.

Joined: 23 November 2007
Posts: 13715

Posted: 25 January 2011 at 10:54pm | IP Logged
@fizzy....ishhhhh i m in luv wid ur creationsBlushing

The following 1 member(s) liked the above post:

naadanmasakalli

__Shruti Senior Member
__Shruti
__Shruti

Joined: 24 July 2010
Posts: 407

Posted: 25 January 2011 at 11:26pm | IP Logged
@ -Maha- Awesome creations...love all of them!! Thumbs UpDay Dreaming
 @Sweet_Kandy I love the Harshad's icons n AvisSilly..OMG...m soo dead after seeing these...tooooo awesemeDay Dreaming BlushingParty
 @-Fizzylicious- Awesome creations...love it...love the dance sequence...Thanks alot for such wonderful creations!! ClapEmbarrassed



The following 2 member(s) liked the above post:

Sweet_Kandynaadanmasakalli

.Angel IF-Stunnerz
.Angel
.Angel

Joined: 31 May 2008
Posts: 36388

Posted: 26 January 2011 at 12:37am | IP Logged
priya_kinshu, Maha, Aisha, Samia, Manasi and Faru......wow Outstanding and amazingly marvelous creations guysClapClapClapClapClapClap

The following 4 member(s) liked the above post:

Sweet_Kandymanasi_31-Maha-naadanmasakalli

-Hoor- IF-Sizzlerz
-Hoor-
-Hoor-

Joined: 07 October 2006
Posts: 17942

Posted: 26 January 2011 at 1:11am | IP Logged
Gorgeous work Aisha, Maha, Fary, Manasi, Samia, Priya nd all the others whom im forgetting.. Tongue


Edited by -Hoor- - 26 January 2011 at 1:12am

The following 4 member(s) liked the above post:

Sweet_Kandymanasi_31-Maha-naadanmasakalli

anu93 IF-Sizzlerz
anu93
anu93

Joined: 07 August 2010
Posts: 16092

Posted: 26 January 2011 at 1:17am | IP Logged
Fab creations by allClapClap
harshad.diwani Goldie
harshad.diwani
harshad.diwani

Joined: 13 June 2010
Posts: 1391

Posted: 26 January 2011 at 1:32am | IP Logged


http://i55.tinypic.com/55mpls.jpg

The following 29 member(s) liked the above post:

zoyazulsophiamsoniroyAlisha_AAnita16aliyarkashrishnilminparvink-Riyal-taarey-mananShaily.chaha_khanminaz296DEEENCH-Zeenat-manasi_31xx-Rai-xx-Hoor--Maha-Meehak..shona.AS...AngelpratsysitakshiiSunShine_Amishti_17naadanmasakalli

harshad.diwani Goldie
harshad.diwani
harshad.diwani

Joined: 13 June 2010
Posts: 1391

Posted: 26 January 2011 at 1:33am | IP Logged


http://i56.tinypic.com/xbk40k.jpg


Edited by harshad.diwani - 26 January 2011 at 1:34am

The following 30 member(s) liked the above post:

zoyazulsophiamsoniroyAlisha_AAnita16aliyarkashrishnilminparvinkminaz296-Riyal-taarey-mananShaily.chaha_khanDEEENCH-Zeenat-manasi_31xx-Rai-xx-Maha-Meehak..shona.-Hoor-AS...AngelSoaps1pratsySunShine_Amishti_17sitakshiinaadanmasakalli

Go to top

Related Topics

  Topics Author Replies Views Last Post
Vandy's Creations:*Bheegi Bheegi* new!! 10/08

2 3 4 5 6 7 ... 54 55

Author: -vandy-   Replies: 436   Views: 21231

-vandy- 436 21231 15 February 2012 at 11:50pm by -HarshUrooj-
ll SamCrtz ll taanu tujhe mein rab(FV) pg.9

2 3 4 5 6 7 8 9

Author: Sweet_Kandy   Replies: 69   Views: 8349

Sweet_Kandy 69 8349 19 January 2011 at 10:16am by -Hina-
|| *Tere Liye Picture Gallery (No Comments)* ||

2 3 4 5 6 7 ... 152 153

Author: SunShine_A   Replies: 1218   Views: 308106

SunShine_A 1218 308106 28 December 2010 at 6:05am by *Resham*
My creation gallery dedicated to Tere Liye

Author: SheVi4life   Replies: 5   Views: 1571

SheVi4life 5 1571 03 November 2010 at 12:57am by sadffi
|| *Tere Liye Creation Gallery* ||

2 3 4 5 6 7 ... 146 147

Author: SunShine_A   Replies: 1169   Views: 111068

SunShine_A 1169 111068 29 August 2010 at 2:08pm by khushi2010

Forum Quick Jump

Forum Category / Channels
Forums

Tere Liye Topic Index

  • Please login to check your Last 10 Topics posted

Check these Celebrity also

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index