Fan Fictions

India-Forums

   
Fan Fictions
Fan Fictions

FF : Post wedding part 19 updtd pg 94 last part (Page 45)

gangesegb IF-Dazzler
gangesegb
gangesegb

Joined: 17 November 2010
Posts: 3388

Posted: 09 February 2011 at 1:32pm | IP Logged
loved it...........

The following 1 member(s) liked the above post:

bharkha

ammu5 IF-Sizzlerz
ammu5
ammu5

Joined: 13 December 2010
Posts: 10353

Posted: 09 February 2011 at 10:02pm | IP Logged
PM PLZ

The following 1 member(s) liked the above post:

bharkha

bharkha IF-Sizzlerz
bharkha
bharkha

Joined: 25 October 2010
Posts: 10064

Posted: 09 February 2011 at 11:11pm | IP Logged
swwetshab, trishap, namita and queen ali.....
 
thank u guys.. ll update soon
bharkha IF-Sizzlerz
bharkha
bharkha

Joined: 25 October 2010
Posts: 10064

Posted: 10 February 2011 at 3:28am | IP Logged
thanks gangesegb
ammu: thank u and ll surely pm u.....
bharkha IF-Sizzlerz
bharkha
bharkha

Joined: 25 October 2010
Posts: 10064

Posted: 10 February 2011 at 3:41am | IP Logged

Thank u all of u for liking my update and for posting the comments... thank u once again...

Part: 10

 In my previous part'. Geet bought bangles for annie and rudraksh for dadima'

Maan n geet licking gola'

 Maan ' ye accha hai geet'. Gola toh maine hi kharida tumhare liye.. aur tumne mujhe meri hi cheez diii'..tumne mere liye kuch nahi kharida'..

Geet ' woh nahi maan'''.

Maan ' haan haan bolo''kya kharida tumne..

Geet ' aap ye rudraskh le liljiye'..waise bhi dadima se jyaada aapko iski jaroorath hai..

Maan ' kya kaha tumne

Geet ' jo aapne suna''..aapne suna na..

Maan ' geet

 Geet takes the rudraksh and puts around maan s neck'.

 Maan ' ye tum kya kar rahi ho..

Geet ' ye aapke goosey ko kaboo mein rakhega'.dekha aap apni button jaisi aankhoin se kaise ghoorthey hain'

Maan ' accha toh yeh hotha kii tumne kuch laaya hi nahi hotha..

Geet ' wahi toh.. maine kuch laaya hi nahi tha aapke liye'wahaan pe aapke liye kuch milega kya'.par nahi.. aapko toh jhagda shuru karna hai.. aur jab maine dadima ke liye laayii hui cheez dii toh phir jhagda'. Laau toh jhagda naa laau toh jhagda'..

 Maan ' main gola se hi kam chala loonga geet'yeh rudraksh ki mala tum dadima ko hi de dena..

 He removes it and gives it to her'

Geet ' bahooth jaldi akaal aa gaayee aapko

Maan ' kya'. Waise ek baath kahu..tum mere saath rehtey rehtey smart ho gaayee ho..

Geet ' aap ye kyun nahi kehthey' aapko mere saath saath rehke.. smartness dikhaayee dene lag gaayee hai'

 Maan staring at her'..

Geet ' baad mein ghoor lejiyega'jaldi chaliye.. ghar jaldi jo pahoochna hai'.

 They reach home'.

 On the way to home.. geet was thinking about the guy whom she had seen somewhere n maan thinking abt rajji'but they both don't say anything to each other'.they reach home'Dadima happy to see maan n geet back home''..

 Maan ' dadima.. annie kahaan hai..

Dadima ' abhi abhi aaye ho.. thoda aaram kar lijiye'. Annie apne kamre mein hai'

Maan goes to her room.. geet n dadima follows him..

They find annie asleep' they leave from her room'

Dadima 'annie ki tabiyeth pehle se theek hai.. kuch ghabraane waali baath nahi hai'kal subhay mil lijiyega' ab aap log bhi aaram kar lijiye.. thak gaaye hoge'

 Next day'.maan going to office.. even geet accompanying office along with maan

 Annie decides to find out about sunaina'.. arjuns fiance'

Annie decides to meet the doctor who revealed to her abt arjun s engagement status'

She says at home that she gonna go to see the doctor for routine check up as she was not feeling well..

Geet says she ll accompany her..so geet goes along with annie to the hospital instead of office'they both go to the same lady doctor'. But in vain.. doc doesn't reveals anything.. she says arjun only said her that they are engaged.. and sunaina lives abroad'annie is still suspicious' she thinks arjun is not engaged and is tryin to fool her''''.

 In the hospital geet sees the same person'. She was now able to see his face clearly' she recognized him.. its none other than rahul'' she remembers how he commented on her when her saree tore off during the kurbaan hua sequence'..

 Geet then pacifies herself by telling that it must have been a co ' incidence'.even he came to dargah'mite be accidently as he was in a hurry he had pushed her'.

 Annie goes home and geet leaves to office'..

 Pinky 'oye geet'. Kaisa raha tera honeymoon

Geet ' pinky' tum shayad bhool rahi ho.. hum sab saath hi toh gaaye they camping ke liye'

Pinky ' haan na.. main bhi kitani bhuddhu hoo

Geet ' pinky.. main tujhe acchey se jaanthi hoon' chal baatha tujhe aur koi baath pareshaan kar rahi hai kya'.

Pinky ' (she sees adi coming towards them) aissi koi baath nahi hai geet'..

Adi ' hello geet'. Tumhe office mein dekhke aacha laaga'

Pinky ' (in her mind).. bus aap mujhe dekh ke hi khush nahi huye hoge'

Geet ' haan adi sir.. maine socha.. kyu na maan ki haath baata loo

Adi ' ye bada naik khayal hai geet.. waise bhi office ka work load  bhad raha hai' pinky chalo tum bhi apna kam karo'.

 Pinky so irritated'.she leaves from there..

Geet now understands that pinky is irritated with adi'.

 Geet ' gud work adi sir'.(she winks at him and leaves)

Adi smiles''''..

 Maan sees geet winking at adi'

Geet enters maan s cabin

Maan ' ye tum adi ke saath kya kar rahi thee

Geet ' aur kya baath kar rahi thee

Maan ' woh toh maine dekha' lekin tumne adi ko aankh kyu maara'

Geet- accha ab samajh mein aaya'kyunkii''. Meri marzi

Maan ' kya' meri marziii

Geet ' haan''..

Maan ' theek hai geet' ab dekho main apni marzi kaise challatha hoon'

Geet ' (scared) nahi nahi.. main toh sirf mazzak kar rahi thee'.. woh toh maine adi sir ko aankh isiliye maari kyunki main unke pinky ko ignore karne waale idea se khush thee' unke bina boley hi main samajh gaaye thee unke idea ko'.

Maan ' toh ismein aankh maarne ki kya jarrorath thee' tum usse keh bhi toh sakthi thee na.. aaj tak mujhe toh kabhi tumne aankh nahi maara'

Geet moves close to maan'..

Geet ' main aapko apne dono aankhoin se dekhna chahthii hoo'ek aankh se nahi'

Maan ' hmmmm'. Tum na geet.. .. aage se is baath ka khaas dhyaan rakhna kit um kissi ko aankh nahi marogi sivaaye mere.. samjhi tum'.

Geet ' theek hai baaba'. Ab khush'

 Maan ' hmmm' annie ki tabiyeth kaisii hai.. doctor ne kya kaha

Geet ' annie pehle se behathaar hain' doctor ne usse kuch din ke liye aaram karne ko kaha hai..woh maan main aapse kuch kehna chahthii thee

Maan ' haan bolo geet
geet ' waise koi badi baath nahi hai' lekin maine kal dargah main rahul ko dekha'

Maan ' (he remembers rahul' and geet was shattered after kurbaan hua sequence bcoz of him)'. Accha hua geet.. tumne mujhe baatha diya'

Geet ' woh maan.. aap meri fikaare math kijiye' shaayad woh aisey hi takra gaaya hoga mujhse dargah mein'aur aaj maine usse hospital mein bhi dekha'..

Maan ' theek hai geet

 maan pretends to be normal'.but hundreds of things are running in his head.. rahul.. what was he doing there'. Did he push geet wantedly' the list goes on

Suddenly he remembers about rajji'. He thinks geet revealed him the truth.. even he shudnt hide it from her'''.

 Maan ' geet mujhe coffee chahiye'.

Geet ' abhi laathi hooon'

She leaves

 Maan calls pinky

Pinky ' maan sir'. Aapne bulaaya

Maan ' pinky main tumhe tumhare jiju ke hasiyeth se bulaaya'.tumhe ek baath baathani thee

Pinky ' (puzzled)

Maan ' woh pinky.. geet aur adi milke tumhe thang kar rahe hai.. adi tumhe chahtha hai. Aur haan mujhe ye bhi paatha hai tum bhi usse chahthi ho'

Woh dono jaan mooch ke tumhe pareshaan kar rahe hai.. aur tumhare muh se sunna chahthey hai ki tum adi se pyaar karti ho.. halaanki vo ye jaanthey hai'.

Pinky ' kya'. Geet' adi sir'. Tum dono ko main nahi chodoongi'(then realizes what she just blabbered)  aisa kuch bhi nahi hai maan jiju

Maan ' kudh  se jhoot bolna band karo aur mujhse bhi'.

Pinky ' hmmm'.. toh ab main kya karuu..

Maan ' tum unka idea unpe hi use karro'. Mera mathlab hai kii adi ko ignore karo aur uske samne kissi aur ko bhav do'

Pinky - yeh sahi rahega

Maan ' maan singh khuraana hamesha sahi rehtha hai..

Pinky ' thank u jiju..

Maan ' pinky.. woh mujhe tumse ek kaam tha.. tum toh geet ki bachpan ki saheli ho na.. kya tum mujhe rajji ka number de sakthi ho'' shaayad Mr. manchanda ke paas ho..

Pinky ' haan jiju.. papa ke paas hai'main abhi unse leke dethi hoon

Maan ' woh.. is baath ka khaayal rakhna kii.. geet ko is baare mein bilkul paatha na chale'.

Pinky ' theek hai.. abmain jaau

Maan ' haan.. tum jaa sakthi ho'

 Pinky feels so happy after knowing about adi and pinky.. she now tells herself' ab main aur maan sir milke geet aur adi ko kaise sabak sikhathey hai'

She takes rajji s number from her dad and gives it to maan'

 Maan calls rajji.. they speak and the call is cut..

 Geet enters'.

Maan ' geet tumhe ithni der kahaan lag gaayee

Geet ' woh adi sir ke saath baath kar rahi theee' unhe meri madaath chahiye thee'

Sorry.. ye lijiye aapki black coffee'

Maan ' thank u geet

Geet ' aap badey khush lag rahe hai.. kya baath hai..

Maan ' hmmmm'.main hamesha hi khush rehtha hoon geet'

Geet ' hamesha khush rehthey hai aap.. apni shaakal dekhi hai aaine mein..

Maan ' geet'. Har baath par behas karna jarroori hai kya'. Mujhe office mein bahooth kam hai'..

Geet ' waisey acchi baath hai.. aap khush hai toh.. aapko muskuraatha hua dekh kar dil ko sukoon miltha hai..

Maan ' tumhi meri muskurahat ki wajah ho geet.. jab se tum meri zindagii mein aayee ho.. tumne meri zindagii rangoin se bhar dii hai'.

 comments and criticism are always welcome.......

 


Edited by bharkha - 10 February 2011 at 3:43am

The following 57 member(s) liked the above post:

ssssmarpyarisaheliramavishkanchan23gagsyasmi123krishna.namitasinnonabebumans22MSgayatripari_DDshruthiruchssahibasharmaTamanna_TJQueenbeePallavibobbydollTishuumaaneetkimeetshivangi783abina03heermehermausam19maanshiMaaneet4evegangesegbsimi91mrk-1meravigilisosanu3108Krishnaluv94shruti_luvs_msk-TeriMalang-kooliioswetha10divareenaRajeevGurtiFanhinal_maaneetnanditasinghmchopra--aarthi--shah10preethiaTeju_wkar--Ratna--rsroopaliSabmeratu.ammu5maaneetsangelsaanjh11Loquacious_Aash_BlackPearl_tamanna1391Madhuri53dewdropredkhwaishfanSecretKhabri420

maansee IF-Sizzlerz
maansee
maansee

Joined: 29 June 2010
Posts: 20777

Posted: 10 February 2011 at 3:57am | IP Logged

Clapgood job..... ye rahul phir sey Angry

Clap feeling happy that adi/pinky Winkstory going on

Clapdelight to see maan giving tips to pinkyLOL

Claphappy for maans smileSmile

Clap geet to as usual mind blowing Star

Clapand for u a big Hug



Edited by maansee - 10 February 2011 at 4:28am

The following 1 member(s) liked the above post:

bharkha

maanluvsgeet IF-Sizzlerz
maanluvsgeet
maanluvsgeet

Joined: 15 September 2010
Posts: 15232

Posted: 10 February 2011 at 4:00am | IP Logged

hey thnx 4 d pm dear. loved it

The following 1 member(s) liked the above post:

bharkha

meravigiliso IF-Rockerz
meravigiliso
meravigiliso

Joined: 31 July 2010
Posts: 5940

Posted: 10 February 2011 at 4:01am | IP Logged
lovely.lets see how pinky is going to do against asi and geet. pasa ulta padne wala hai. whats is going in the mind of maan regarding rajji.do update asap.

The following 1 member(s) liked the above post:

bharkha

Go to top

Related Topics

  Topics Author Replies Views Last Post
~*Fan Fic-Tu Muskura*~ *LAST PART, PART 16 PG 93*

2 3 4 5 6 7 ... 111 112

Author: Maaneet-Fan   Replies: 892   Views: 193090

Maaneet-Fan 892 193090 11 December 2013 at 7:06am by anomalousmishty
...

2 3 4 5 6 7 ... 55 56

Author: -Crayon-   Replies: 446   Views: 61645

-Crayon- 446 61645 12 October 2012 at 7:59pm by PoojaSheth
CLOSED

2 3 4 5 6 7 ... 36 37

Author: luvabbybaby   Replies: 289   Views: 72190

luvabbybaby 289 72190 12 October 2012 at 7:55pm by PoojaSheth
A LOT LIKE LOVE#2-part 40 pg 128(LAST PART)

2 3 4 5 6 7 ... 149 150

Author: barkha_90   Replies: 1198   Views: 535555

barkha_90 1198 535555 05 May 2012 at 3:10am by TANVI_SEXY
Bewafa-LAST PART(pg.44)2nd to last(pg.43)

2 3 4 5 6 7 ... 55 56

Author: simplyconfused   Replies: 441   Views: 131373

simplyconfused 441 131373 07 February 2006 at 9:12pm by nabz8888

Forum Quick Jump

Forum Category / Channels
Forums

Fan Fictions Topic Index

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index