Sasural Genda Phool
Sasural Genda Phool

India-Forums

   

Awesome Episode Today

biryani IF-Dazzler
biryani
biryani

Joined: 03 December 2006
Posts: 4718

Posted: 19 May 2010 at 10:09am | IP Logged

SmileHi Guys Awesome episode todayBig smile

LOLSuShaan Awesome & rock todayLOL

WinkHot & Brilliant chemistry btw SuShaanWink
The Show Is Rocking Wid Jay & RaginiThumbs Up

HeartClapLove Theri chemistry alotClapHeart

The following 6 member(s) liked the above post:

kuchikivishmewellcherrypansypriyankumupalmaheen55-allizwell-

jaya_1234 Groupbie
jaya_1234
jaya_1234

Joined: 19 January 2010
Posts: 61

Posted: 19 May 2010 at 1:08pm | IP Logged
Awesome,  lovely, cute episode.... muwaaah muwaah mumuwah....StarStarStarStarStartooooooooooo good an episode....SGP is undoubtly the best show on SPClapClapClapClapClapClap....better than Pratigya (which is loosing its sheen now a days.....UnhappyUnhappyUnhappyUnhappyUnhappy) . I love the simplicity and innocsense of the people in Kashyap family, wish i had a sasural like that.....WinkWinkTongueTongue...love
Suhana...dil jeet liya usne mera...after watching yesterday's sepisode (cofee vs. chapati) I was unhappy with Suhana thinking that she is selfish...but in today's episode, she dispelled all my doubts and unhappiness...she is choooo cute...so childlike and innocent...badi maa was right about her...that she doesnt keep grudges in her heart...love u Suhana...Last but not the least../.Ishaan..loved him in today's episode...this chap surely knows haow to tackle Suhana...I cud make it out from the way he insisted Suhana to at least have a look at the ring...and his reaction after seeing suhana's happiness....OMG...so cute.... HeartHeartHeartHeartHeart...and then the dance sequence...i was surprised to see Suhana's facial experession...was unable to move my gaze from her face.....And Ishaan...he seems to be a traine d dancer...but honestly suhana stole the show....The song setup was awesome...Kudos to the director , and creatives...love yaClapClapClap

The following 6 member(s) liked the above post:

vishmewellbiryanicherrypansymaheen55-allizwell-YusBee

vishmewell Goldie
vishmewell
vishmewell

Joined: 12 July 2006
Posts: 2460

Posted: 19 May 2010 at 3:44pm | IP Logged
Haaaaaiiillllaaaa !!!! Aaaaawwwweeeessssooommmmeeee episode... Day DreamingDay DreamingDay DreamingDay DreamingDay DreamingDay DreamingDay Dreaming

Childish ans innocent Suhana... the way she forced Ishaan to give her the ring...Day DreamingDay DreamingDay Dreaming hmmm... ithni haqse maangi ring... Day DreamingDay DreamingDay Dreaming
the way she lied to Ishika to protect Ishaan was super cute...Day DreamingDay Dreaming
Suhana's reaction after putting the ring on hmm Day DreamingDay Dreaming

her interaction with mithii and spoiling her was super duper cool... LOL

The following 5 member(s) liked the above post:

biryanicherrypansymaheen55111192-allizwell-

Hajoo Senior Member
Hajoo
Hajoo

Joined: 01 April 2008
Posts: 223

Posted: 19 May 2010 at 5:04pm | IP Logged
yaa today's episode was really rocking!! i watched like 3 times, my mom was like "r u k? this is the third time!!" i was "moomm! i am just loving thiss Big smile"
Ishan and Suhana totally rock!!!

The following 3 member(s) liked the above post:

vishmewellbiryani-allizwell-

416905 Goldie
416905
416905

Joined: 29 December 2005
Posts: 1227

Posted: 19 May 2010 at 7:54pm | IP Logged
Suhana has the best'est' expressions ever. Loved every bit of the episode today. Suhana's character is so positive and childlike, absolutely innocent and loveble! Even loved Rajini today. She is so sweet and even she couldn't help but smile and Suhana. Today's episode totally rocked!! Loved the ring scene and the way Suhana says "yeh to meri ring hai"!Thumbs Up

The following 2 member(s) liked the above post:

biryani-allizwell-

  • Page 1 of 1

Go to top

Related Topics

  Topics Author Replies Views Last Post
today 1st part so funny

Author: remosalsa   Replies: 4   Views: 900

remosalsa 4 900 17 May 2010 at 9:13am by remosalsa
Episode Highlights- 13th May

Author: misty85   Replies: 6   Views: 1901

misty85 6 1901 13 May 2010 at 8:16pm by aparakshitij
5/7: Random Thoughts on today's episode

2 3 4

Author: LadyMcbeth   Replies: 24   Views: 1694

LadyMcbeth 24 1694 08 May 2010 at 9:02pm by LadyMcbeth

Forum Quick Jump

Forum Category / Channels
Forums

Disclaimer: All Logos and Pictures of various Channels, Shows, Artistes, Media Houses, Companies, Brands etc. belong to their respective owners, and are used to merely visually identify the Channels, Shows, Companies, Brands, etc. to the viewer. Incase of any issue please contact the webmaster.

Popular Channels :
Star Plus | Zee TV | Sony TV | Colors TV | SAB TV | Life OK

Quick Links :
Top 100 TV Celebrities | Top 100 Bollywood Celebs | About Us | Contact Us | Advertise | Forum Index